DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and CG9609

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_573161.1 Gene:CG9609 / 32663 FlyBaseID:FBgn0030787 Length:403 Species:Drosophila melanogaster


Alignment Length:433 Identity:97/433 - (22%)
Similarity:156/433 - (36%) Gaps:108/433 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 PPDEGLKENHEENEHELEEEHEKQADGQQVDLSK------KQEDQKKILDDREDEEYPDEYENSQ 154
            ||...:..: .:.|..|||..::|.....:..:|      |.|...|.||..:..||        
  Fly     2 PPGTQIASD-SDMETALEEFKQRQGRRNSIGSAKYACSMPKCEATFKRLDQLDRHEY-------- 57

  Fly   155 QQLSQGTGSKRRAGLACDQCGKQVYKLPYLEAHIRSVHQ----GYSKPFLC--RSCDKSFTRYEQ 213
                ..||.|:.| .:.:.|.|....:.:|:.|:||.|:    ...|...|  ..|.|.|.....
  Fly    58 ----HHTGIKKHA-CSYEGCDKTYSIVTHLKRHLRSTHERPESAAKKTVKCALEECSKMFISVSN 117

  Fly   214 LRSHMRNAH--PQLEQLQQELRDLICELCNRQYSTKNALGEH-LKRHAQRKEHVCEHCGVAKVTR 275
            :..|||..|  |::..         |..|:.::|.|..|..| ::.|.....:.|..|......:
  Fly   118 MTRHMRETHESPKVYP---------CSQCSAKFSQKLKLKRHEIREHTLEYPYSCSKCSRGFYQQ 173

  Fly   276 TELLTHLRTHNPTWERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVRH- 339
            .:    .::|.|:.:.::|..||..|...:..::|.|....|:.|.:|..|:..|...:...|| 
  Fly   174 WQ----CQSHEPSCKLYECPGCPLQFDKWTLYTKHCRDSLHGKNRHKCDRCDSAFDKPSELKRHL 234

  Fly   340 ERLHTESTGSGEAAEEWP----------------------------FAC--IHCQKPCVSRQTLE 374
            |..|.|:..:.|.|..:.                            |.|  :.|.:...|.|.|.
  Fly   235 EVKHKEAAQTDECATSFTCNEEGCGKSYSYLRNLRQHMLTAHSGRRFECQALDCGRCFSSAQNLA 299

  Fly   375 LHLRRH------------------------RARKTHRKRR------EHSRESQEQEQEHDRDQEQ 409
            .||.|.                        :.:.|.||||      :|||.|:....:.|::.::
  Fly   300 RHLLRDHKDGATKKELKAKKKDKSKTGEGGKTKSTSRKRRRDAGRSKHSRLSKLACLQLDKEDDE 364

  Fly   410 GAREAQQDQLRKGEKLRQRDLSRESHRNEVTMQTSQRPNECQQ 452
            ..||.|...|   ||:.|.  .::....|:..||.|...|.:|
  Fly   365 AVRERQPLVL---EKITQS--LKDDPVEELLAQTLQDEEEKEQ 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071
C2H2 Zn finger 171..192 CDD:275368 6/20 (30%)
zf-C2H2_2 201..>257 CDD:289522 15/60 (25%)
C2H2 Zn finger 201..222 CDD:275368 7/22 (32%)
C2H2 Zn finger 237..257 CDD:275368 6/20 (30%)
C2H2 Zn finger 265..285 CDD:275368 2/19 (11%)
zf-C2H2_8 268..349 CDD:292531 19/81 (23%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 6/20 (30%)
C2H2 Zn finger 360..380 CDD:275368 7/21 (33%)
CG9609NP_573161.1 C2H2 Zn finger 40..59 CDD:275368 7/30 (23%)
zf-C2H2_8 67..150 CDD:292531 22/91 (24%)
C2H2 Zn finger 67..90 CDD:275368 6/22 (27%)
C2H2 Zn finger 106..126 CDD:275368 6/19 (32%)
C2H2 Zn finger 134..155 CDD:275368 6/20 (30%)
C2H2 Zn finger 188..210 CDD:275368 6/21 (29%)
C2H2 Zn finger 217..237 CDD:275368 6/19 (32%)
C2H2 Zn finger 253..276 CDD:275368 0/22 (0%)
C2H2 Zn finger 283..302 CDD:275368 5/18 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.