DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and CG42726

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:436 Identity:93/436 - (21%)
Similarity:149/436 - (34%) Gaps:152/436 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 TGSKRRAGLACDQCGKQVYKL-------PYLEAHI-RSV---------------------HQGYS 196
            ||..|   |..|.||....:|       ..||..: |||                     .:||.
  Fly    12 TGQNR---LVTDSCGHTKCRLCLVADVSDCLECRVARSVDIQETQETQARTSADKRIIVTDKGYH 73

  Fly   197 KPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQQELRDLICELCNRQYSTKNALGEHLKRHAQRK 261
                |..|:|.|....|...|:...:..|::..       |:.|.|:::|.:.|..||..|.::.
  Fly    74 ----CTVCNKDFRSRTQQYYHLTCGNDLLKKFN-------CKECGRRFATSSHLKYHLMSHEKQS 127

  Fly   262 EHVCEHCGVAKVTRTELLTHLRTHNPTWERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHC 326
            :|.|..|..:......|..|:.|||.  |:..|..|.::||.||:::.|:.:..:...:|:|..|
  Fly   128 KHSCSVCHKSFKQPIVLQRHMLTHNQ--EKHLCPICQKVFRRKSSLASHLAIHSDLGLQFKCELC 190

  Fly   327 EKKFGTHASQVRHERLHTESTGSGEAAEEWPFACIHCQKPCVSRQTLELHLRRHRARKTHRKRR- 390
            .|.|...|:..:|.|.|.::        .....|..|||..:.:.||.||::||    ::|:|: 
  Fly   191 SKHFQNKANLNQHLRKHDKN--------NIRHMCKVCQKSFLRQTTLRLHMKRH----SNRERQS 243

  Fly   391 ---------------EHSRESQEQEQ-----------------EHDRDQEQG------------- 410
                           .|.|:.:..|:                 .|.|....|             
  Fly   244 CSLCGKSYNDPDALGRHLRQHKTAERYRCIQCDITINRKDNMLRHLRSMHPGCAFASTVEMVTPR 308

  Fly   411 --AREAQQDQLRKGEKLRQRDLSRESHRNEVTM--QTSQRPNECQQGQ----------------- 454
              |:||...:.|..:.:|...:.:.....|..|  |::..|::..:.|                 
  Fly   309 SSAQEATTAEERPSQTVRYNSVIQSVGNVEPVMLLQSTPLPSQLPELQMEKGKAVPEHLPLPDVM 373

  Fly   455 -----------------ESYDPEPDPLEASQCKLEQEDALDPEWQH 483
                             |.|..||.|           ||.:|..||
  Fly   374 PEENVQLYRKIILDLDNEEYSSEPSP-----------DAQEPAMQH 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071
C2H2 Zn finger 171..192 CDD:275368 9/49 (18%)
zf-C2H2_2 201..>257 CDD:289522 14/55 (25%)
C2H2 Zn finger 201..222 CDD:275368 6/20 (30%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 265..285 CDD:275368 4/19 (21%)
zf-C2H2_8 268..349 CDD:292531 23/80 (29%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
C2H2 Zn finger 360..380 CDD:275368 8/19 (42%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368 6/19 (32%)
C2H2 Zn finger 103..123 CDD:275368 7/19 (37%)
COG5048 <112..288 CDD:227381 45/189 (24%)
C2H2 Zn finger 131..151 CDD:275368 4/19 (21%)
Chordopox_A33R 151..>254 CDD:283591 31/116 (27%)
C2H2 Zn finger 158..178 CDD:275368 7/19 (37%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 8/19 (42%)
C2H2 Zn finger 244..264 CDD:275368 2/19 (11%)
C2H2 Zn finger 272..290 CDD:275368 1/17 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457186
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.