DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and CG2120

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_572446.2 Gene:CG2120 / 31737 FlyBaseID:FBgn0030005 Length:315 Species:Drosophila melanogaster


Alignment Length:163 Identity:56/163 - (34%)
Similarity:75/163 - (46%) Gaps:22/163 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 CDQCGKQVYKLPYLEAHIRSVHQGYSKPFLC--RSCDKSFTRYEQLRSH--MRNA--------HP 223
            ||.|||......||..| |.:|.| .||:.|  ..|..||......|.|  :|:|        ||
  Fly   157 CDICGKGFRYANYLTVH-RRLHTG-EKPYPCLATDCHLSFHSIHARRIHTKLRHAAQTDPDPEHP 219

  Fly   224 QLEQLQQELRDL--ICELCNRQYSTKNALGEHLKRHAQRKEHVC--EHCGVAKVTRTELLTHLRT 284
            ..||.|::...|  .|.:|:|..:.:..|..|||||..:::..|  ..||....:.:||..|...
  Fly   220 LAEQEQRDTSALSFTCPVCSRVLTDQCYLSIHLKRHYNQRDFPCPQPECGKRFFSASELKHHQIA 284

  Fly   285 HNPTWER-FKCEQCPQLFRHKSAISRHVRVVHE 316
            |  |.:| |.|..||..|..||...:|:: |||
  Fly   285 H--TQQRPFACPLCPARFLRKSNHKQHLK-VHE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071
C2H2 Zn finger 171..192 CDD:275368 9/20 (45%)
zf-C2H2_2 201..>257 CDD:289522 21/69 (30%)
C2H2 Zn finger 201..222 CDD:275368 8/32 (25%)
C2H2 Zn finger 237..257 CDD:275368 7/19 (37%)
C2H2 Zn finger 265..285 CDD:275368 6/21 (29%)
zf-C2H2_8 268..349 CDD:292531 19/50 (38%)
C2H2 Zn finger 294..315 CDD:275368 7/20 (35%)
C2H2 Zn finger 323..343 CDD:275368
C2H2 Zn finger 360..380 CDD:275368
CG2120NP_572446.2 C2H2 Zn finger 101..121 CDD:275368
zf-H2C2_2 113..138 CDD:290200
C2H2 Zn finger 129..149 CDD:275368
zf-H2C2_2 142..166 CDD:290200 5/8 (63%)
COG5048 151..>264 CDD:227381 36/108 (33%)
C2H2 Zn finger 157..177 CDD:275368 9/20 (45%)
C2H2 Zn finger 185..206 CDD:275368 6/20 (30%)
C2H2 Zn finger 235..255 CDD:275368 7/19 (37%)
C2H2 Zn finger 263..285 CDD:275368 6/21 (29%)
C2H2 Zn finger 293..313 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.