DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1529 and Opbp

DIOPT Version :9

Sequence 1:NP_001138223.2 Gene:CG1529 / 33077 FlyBaseID:FBgn0031144 Length:512 Species:Drosophila melanogaster
Sequence 2:NP_724479.1 Gene:Opbp / 246618 FlyBaseID:FBgn0050443 Length:562 Species:Drosophila melanogaster


Alignment Length:433 Identity:92/433 - (21%)
Similarity:148/433 - (34%) Gaps:133/433 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DIDILKQPHGFPTEICNLCHNAVVYFDELRQVARESSQKLIG-----------WQ-----PVDIA 88
            |.:...:.|| |...|  |..|....|.:.:||.:...:.:|           |:     |.::.
  Fly    42 DTESYDRAHG-PQAGC--CTGASGELDFIEEVAEDCISEEVGEEDIVYADVPLWELVEEVPANVK 103

  Fly    89 VDRVKEEPPD---------EGLKENHEENEHELEEEHEKQADGQQVDLSKKQEDQKKILDDREDE 144
            .::.:.||.:         ..:.||..:.|..:....|.....|| |...|...::|:       
  Fly   104 AEKDQNEPSNSDRYFCYDCHSIFENRNKAEEHICPRAESGGSSQQ-DGDAKAPVRRKL------- 160

  Fly   145 EYPDEYENSQQQLSQGTGSKRRAG-LACDQCGKQVYKLPYLEAHIR----------------SVH 192
                      ..:|..||.:..:. ::|..|........:|:.|:|                ..|
  Fly   161 ----------ASVSARTGPRDASSVISCGICNTVFSSEKFLKFHMRIHENRAPKSIQDALPIGAH 215

  Fly   193 QGYSK--PFLCRSCDKSFTRYEQLRSHMRNAHPQLEQLQQELRDLICELCNRQYSTKNALGEHLK 255
            |.||:  .|.|..|:|||.      ..:...|.|:.  |||..:::|.:|||::..:.....|.|
  Fly   216 QQYSELDQFYCEICNKSFD------ETLLTVHKQMH--QQESSEIMCSICNRKFENEVTYQMHQK 272

  Fly   256 RH------------AQR-----------------------------------KEHVCEHCGVAKV 273
            .|            |||                                   |.:.||.||....
  Fly   273 IHEKPRDSESSRKLAQRTSLDKEKPGFPCQYCERVFTRPFEKVKHERVHTGEKPYACEVCGKTFR 337

  Fly   274 TRTELLTHLRTHNPTWERFKCEQCPQLFRHKSAISRHVRVVHEGQRRFQCGHCEKKFGTHASQVR 338
            ....|..|||||. ....:.|..|.:.|:.....|.|:| :|..:|:|.|..|.|.|.|......
  Fly   338 VSYSLTLHLRTHT-NIRPYVCTVCNKRFKSHQVYSHHLR-IHSSERQFSCDACPKTFRTSVQLYA 400

  Fly   339 HERLHTESTGSGEAAEEWPFACIHCQKPCVSRQTLELHLRRHR 381
            |:..||:           |:.|..|.:|..|...::.|::.|:
  Fly   401 HKNTHTK-----------PYRCAVCNRPFSSMYAVKNHMQTHK 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1529NP_001138223.2 zf-AD 11..79 CDD:285071 10/38 (26%)
C2H2 Zn finger 171..192 CDD:275368 5/36 (14%)
zf-C2H2_2 201..>257 CDD:289522 16/55 (29%)
C2H2 Zn finger 201..222 CDD:275368 5/20 (25%)
C2H2 Zn finger 237..257 CDD:275368 6/19 (32%)
C2H2 Zn finger 265..285 CDD:275368 8/19 (42%)
zf-C2H2_8 268..349 CDD:292531 25/80 (31%)
C2H2 Zn finger 294..315 CDD:275368 6/20 (30%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
OpbpNP_724479.1 C2H2 Zn finger 254..274 CDD:275368 6/19 (32%)
C2H2 Zn finger 301..321 CDD:275368 0/19 (0%)
zf-H2C2_2 316..336 CDD:290200 5/19 (26%)
C2H2 Zn finger 329..349 CDD:275368 8/19 (42%)
zf-H2C2_2 341..366 CDD:290200 9/25 (36%)
C2H2 Zn finger 357..377 CDD:275368 6/20 (30%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
C2H2 Zn finger 411..431 CDD:275368 5/19 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24409
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.