DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG1529 and klu-1

DIOPT Version :9

Sequence 1:	NP_001138223.2	Gene:	CG1529 / 33077	FlyBaseID:	FBgn0031144	Length:	512	Species:	Drosophila melanogaster
Sequence 2:	NP_493611.2	Gene:	klu-1 / 173366	WormBaseID:	WBGene00013970	Length:	543	Species:	Caenorhabditis elegans

Alignment Length:	125	Identity:	38/125 - (30%)
Similarity:	52/125 - (41%)	Gaps:	15/125 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   171 CDQCGKQVYKLPYLEAHIRSVHQ-------GYSKPFLCRSCDKSFTRYEQLRSHMRNAHPQLEQL 228
            |..||:.......|..||.|.|:       ..||...|..|.|||:|.:.|..|||        |
Worm   334 CTLCGQAFAVHDRLAKHIASRHRQRSCTLDDASKVHKCNMCSKSFSRSDMLTRHMR--------L 390

  Fly   229 QQELRDLICELCNRQYSTKNALGEHLKRHAQRKEHVCEHCGVAKVTRTELLTHLRTHNPT 288
            ....:...|..||:.:|..:.|..||:.|...|.:.|..|..:...|..:..|:|||:.|
Worm   391 HTGAKPYSCPTCNQVFSRSDHLSTHLRTHTGEKPYACPMCNYSASRRDMISRHMRTHSLT 450

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG1529	NP_001138223.2	zf-AD	11..79	CDD:285071
		C2H2 Zn finger	171..192	CDD:275368	7/20 (35%)
		zf-C2H2_2	201..>257	CDD:289522	18/55 (33%)
		C2H2 Zn finger	201..222	CDD:275368	10/20 (50%)
		C2H2 Zn finger	237..257	CDD:275368	7/19 (37%)
		C2H2 Zn finger	265..285	CDD:275368	5/19 (26%)
		zf-C2H2_8	268..349	CDD:292531	7/21 (33%)
		C2H2 Zn finger	294..315	CDD:275368
		C2H2 Zn finger	323..343	CDD:275368
		C2H2 Zn finger	360..380	CDD:275368
klu-1	NP_493611.2	C2H2 Zn finger	334..354	CDD:275368	6/19 (32%)
		zf-C2H2	369..391	CDD:278523	10/29 (34%)
		C2H2 Zn finger	371..391	CDD:275368	10/27 (37%)
		zf-H2C2_2	383..408	CDD:290200	8/32 (25%)
		COG5048	395..>448	CDD:227381	15/52 (29%)
		C2H2 Zn finger	399..419	CDD:275368	7/19 (37%)
		zf-H2C2_2	411..436	CDD:290200	7/24 (29%)
		C2H2 Zn finger	427..447	CDD:275368	5/19 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	0	0.000