DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1532 and MCEE

DIOPT Version :9

Sequence 1:NP_001285505.1 Gene:CG1532 / 33076 FlyBaseID:FBgn0031143 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_115990.3 Gene:MCEE / 84693 HGNCID:16732 Length:176 Species:Homo sapiens


Alignment Length:161 Identity:37/161 - (22%)
Similarity:60/161 - (37%) Gaps:50/161 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 RAAEHSYPVTQVSGKAGSL-------LTSPDGYK---FYVIDQASASSDPVQSVELNVS----NL 151
            ||:..|.|:.||:|...:|       :..||..|   ||.....:..|:.|...|..||    ||
Human    27 RASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEKAAAFYKNILGAQVSEAVPLPEHGVSVVFVNL 91

  Fly   152 QNSR-KYWHDLLQ----LKVLEENEASVRLSYGEQQASLEITQISEPINRAK------------- 198
            .|:: :..|.|.:    ...|::|:|.     |.....:|:..|:..:...|             
Human    92 GNTKMELLHPLGRDSPIAGFLQKNKAG-----GMHHICIEVDNINAAVMDLKKKKIRSLSEEVKI 151

  Fly   199 -AYGR-IAFAIPAAQQPPLQEAVKAAGGAIL 227
             |:|: :.|..|           |..||.::
Human   152 GAHGKPVIFLHP-----------KDCGGVLV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1532NP_001285505.1 Glo_EDI_BRP_like_21 6..133 CDD:176706 13/41 (32%)
Glo_EDI_BRP_like 143..256 CDD:211348 22/109 (20%)
MCEENP_115990.3 metmalonyl_epim 47..175 CDD:213772 29/141 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.