DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1532 and AT1G67280

DIOPT Version :9

Sequence 1:NP_001285505.1 Gene:CG1532 / 33076 FlyBaseID:FBgn0031143 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_176896.1 Gene:AT1G67280 / 843048 AraportID:AT1G67280 Length:350 Species:Arabidopsis thaliana


Alignment Length:293 Identity:87/293 - (29%)
Similarity:133/293 - (45%) Gaps:60/293 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RALHYVFKIGDRAKNAFFFRQILGMTVLRHEEFKEGCDAACNGPYDNRWSKTMVGYGPESSHFVI 71
            |.||.|:::||..:...|:.:.|||.:||..:..|           .:::...:|||||.|||||
plant    88 RMLHVVYRVGDMDRTIKFYTECLGMKLLRKRDIPE-----------EKYTNAFLGYGPEDSHFVI 141

  Fly    72 ELTYNYGVSSYEMGNDFGGVTIHSKDILSRAAEHSYPVTQVSGKAG----------------SLL 120
            ||||||||..|::|..||...|...|:       :..|..|..|.|                :.:
plant   142 ELTYNYGVDKYDIGAGFGHFGIAVDDV-------AKTVELVKAKGGKVSREPGPVKGGKTVIAFI 199

  Fly   121 TSPDGYKFYVIDQASASSDPVQSVELNVSNLQNSRKYWHDLLQLKVL------EENEASVRLSYG 179
            ..||||||.:::: ..:.:|:..|.|.|.:|..:.|::.....:::|      |.......:.||
plant   200 EDPDGYKFELLER-GPTPEPLCQVMLRVGDLDRAIKFYEKAFGMELLRTRDNPEYKYTIAMMGYG 263

  Fly   180 EQQ--ASLEITQ---ISEPINRAKAYGRIAFAIPAAQQPPLQEAVKAAGGAILT---PLITLDTP 236
            .:.  ..||:|.   ::| .::..||.:||.......:  ..||:|..||.|..   ||     |
plant   264 PEDKFPVLELTYNYGVTE-YDKGNAYAQIAIGTDDVYK--TAEAIKLFGGKITREPGPL-----P 320

  Fly   237 GKATVTVVILGDPDGHEICFVDEEGFGQLSQVE 269
            |.:|.....| ||||.:..|||...|  |.::|
plant   321 GISTKITACL-DPDGWKSVFVDNIDF--LKELE 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1532NP_001285505.1 Glo_EDI_BRP_like_21 6..133 CDD:176706 47/141 (33%)
Glo_EDI_BRP_like 143..256 CDD:211348 33/126 (26%)
AT1G67280NP_176896.1 PLN02300 65..350 CDD:215169 86/291 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9376
Inparanoid 1 1.050 104 1.000 Inparanoid score I2136
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D824414at2759
OrthoFinder 1 1.000 - - FOG0005578
OrthoInspector 1 1.000 - - otm2823
orthoMCL 1 0.900 - - OOG6_105403
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3441
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.