DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1532 and glod5

DIOPT Version :9

Sequence 1:NP_001285505.1 Gene:CG1532 / 33076 FlyBaseID:FBgn0031143 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001018514.1 Gene:glod5 / 553706 ZFINID:ZDB-GENE-050522-174 Length:163 Species:Danio rerio


Alignment Length:188 Identity:49/188 - (26%)
Similarity:72/188 - (38%) Gaps:55/188 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 SGKAGSLLTSPDGYKFYVIDQASASSDPV-----QSVELNVSNLQNSRKYWHDLLQLKVLEENEA 172
            |..:.|:|:.....:|       .||.||     ..:.|.|.:|..:.|::.::|.::|:.....
Zfish    16 SSNSKSVLSGLSSVRF-------RSSCPVLISHLDHLVLTVRDLNKTTKFYSEVLGMEVVTFKGD 73

  Fly   173 SVRLSYGEQQASLEITQISEPINRAKAYGRIAFAIPAAQQPPLQEAVKAAGGAILTPLITLDTPG 237
            ...||:|||:.:|.  |:.:...            |.||.|       ..|.|.|. ||| .||.
Zfish    74 RKALSFGEQKINLH--QVGKEFE------------PKAQTP-------TPGSADLC-LIT-KTPL 115

  Fly   238 KATVTVVILGDPDGHEICFVD-EEG----FGQLSQVES----DGDKRLDRNIEKDPFQ 286
            ||..        |..:.|.|. |||    .|.:..:.|    |.|   |..||...:|
Zfish   116 KAVA--------DHLKACGVTIEEGPVDRTGAVGPISSLYFRDPD---DNLIEVSNYQ 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1532NP_001285505.1 Glo_EDI_BRP_like_21 6..133 CDD:176706 4/19 (21%)
Glo_EDI_BRP_like 143..256 CDD:211348 28/112 (25%)
glod5NP_001018514.1 Glo_EDI_BRP_like_2 39..161 CDD:176676 40/155 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.