DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1532 and GLOD4

DIOPT Version :9

Sequence 1:NP_001285505.1 Gene:CG1532 / 33076 FlyBaseID:FBgn0031143 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001376654.1 Gene:GLOD4 / 51031 HGNCID:14111 Length:364 Species:Homo sapiens


Alignment Length:353 Identity:138/353 - (39%)
Similarity:188/353 - (53%) Gaps:85/353 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RALHYVFKIGDRAKNAFFFRQILGMTVLRHEEFKEGCDAA---CNG------------------- 49
            ||||:|||:|:|.:.|.|:|.:|||.|       |.|..|   |:|                   
Human     5 RALHFVFKVGNRFQTARFYRDVLGMKV-------ESCSVARLECSGAISAHCKLSLPGSHHSPAS 62

  Fly    50 ---------------------------------------------------PYDNRWSKTMVGYG 63
                                                               |||.:|||||||:|
Human    63 ASRVAGTTGAFCGMRNLKKAAKLPVMGMIPCFLKSPLGSDYTRITEDSFSKPYDGKWSKTMVGFG 127

  Fly    64 PESSHFVIELTYNYGVSSYEMGNDFGGVTIHSKDILSRAAEHSYPVTQVSGKAGSLLT-SPDGYK 127
            ||..|||.||||||||..|::||||.|:|:.|...:|.|.:..:|:|:|:  .|...| :|.|||
Human   128 PEDDHFVAELTYNYGVGDYKLGNDFMGITLASSQAVSNARKLEWPLTEVA--EGVFETEAPGGYK 190

  Fly   128 FYVIDQASASSDPVQSVELNVSNLQNSRKYWHDLLQLKVLEENEASVR--LSYGEQQASLEITQI 190
            ||:.:::...||||..|.|.||:||.|..||.:||.:|:.|::|...|  |.|.:.|..||:..:
Human   191 FYLQNR
SLPQSDPVLKVTLAVSDLQKSLNYWCNLLGMKIYEKDEEKQRALLGYADNQCKLELQGV 255

  Fly   191 SEPINRAKAYGRIAFAIPAAQQPPLQEAVKAAGGAILTPLITLDTPGKATVTVVILGDPDGHEIC 255
            ...::.|.|:|||||:.|..:.|.|::.:|.....|||||::|||||||||.||||.||||||||
Human   256 KGGVDHAAAFGRIAFSCPQKELPDLEDLMKRENQKILTPLVSLDTPGKATVQVVILADPDGHEIC 320

  Fly   256 FVDEEGFGQLSQVESDGDKRLDRNIEKD 283
            ||.:|.|.:||:::.:|.|.||..:..|
Human   321 FVGDEAFRELSKMDPEGSKLLDDAMAAD 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1532NP_001285505.1 Glo_EDI_BRP_like_21 6..133 CDD:176706 66/199 (33%)
Glo_EDI_BRP_like 143..256 CDD:211348 56/114 (49%)
GLOD4NP_001376654.1 VOC 4..196 CDD:417478 66/199 (33%)
GLOD4_C 206..321 CDD:319964 56/114 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146008
Domainoid 1 1.000 255 1.000 Domainoid score I2049
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9376
Inparanoid 1 1.050 256 1.000 Inparanoid score I3173
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59570
OrthoDB 1 1.010 - - D390402at33208
OrthoFinder 1 1.000 - - FOG0005578
OrthoInspector 1 1.000 - - oto91834
orthoMCL 1 0.900 - - OOG6_105403
Panther 1 1.100 - - LDO PTHR46466
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3441
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.770

Return to query results.
Submit another query.