DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1532 and Glod4

DIOPT Version :9

Sequence 1:NP_001285505.1 Gene:CG1532 / 33076 FlyBaseID:FBgn0031143 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001014249.1 Gene:Glod4 / 363644 RGDID:1307010 Length:298 Species:Rattus norvegicus


Alignment Length:283 Identity:145/283 - (51%)
Similarity:197/283 - (69%) Gaps:5/283 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ISGRALHYVFKIGDRAKNAFFFRQILGMTVLRHEEFKEGCDAACNGPYDNRWSKTMVGYGPESSH 68
            ::.||||:|||:|:|.:...|||.:|||.|||||||:|||.||||||||.:|||||||:|||..|
  Rat     2 VTRRALHFVFKVGNRFQTVHFFRDVLGMQVLRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDH 66

  Fly    69 FVIELTYNYGVSSYEMGNDFGGVTIHSKDILSRAAEHSYPVTQVSGKAGSLLT-SPDGYKFYVID 132
            ||.|||||||:..|::||||.|:|:.|...:|.|....:|:::|:  .|...| :|.|||||:.|
  Rat    67 FVAELTYNYGIGDYKLGNDFMGLTLASSQAVSNARRLEWPLSKVA--EGVFETEAPGGYKFYLQD 129

  Fly   133 QASASSDPVQSVELNVSNLQNSRKYWHDLLQLKVLEENEAS--VRLSYGEQQASLEITQISEPIN 195
            ::.:.||||..|.|.||:||.|..||.:||.:|:.|::|..  ..|.|.:.|..||:..|...::
  Rat   130 RSPSQSDPVLKVTLAVSDLQKSLNYWSNLLGMKIYEQDEEKKWALLGYADDQCKLELQGIQGAVD 194

  Fly   196 RAKAYGRIAFAIPAAQQPPLQEAVKAAGGAILTPLITLDTPGKATVTVVILGDPDGHEICFVDEE 260
            .:.|:|||||:.|..:.|.|::.:|....:|||||::|||||||||.||||.||||||||||.:|
  Rat   195 HSAAFGRIAFSCPQKELPDLEDLMKRESQSILTPLVSLDTPGKATVQVVILADPDGHEICFVGDE 259

  Fly   261 GFGQLSQVESDGDKRLDRNIEKD 283
            .|.:||:::..|.|.||..:..|
  Rat   260 AFRELSKMDPKGSKLLDDAMAAD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1532NP_001285505.1 Glo_EDI_BRP_like_21 6..133 CDD:176706 73/127 (57%)
Glo_EDI_BRP_like 143..256 CDD:211348 55/114 (48%)
Glod4NP_001014249.1 PLN02300 4..264 CDD:215169 138/261 (53%)
Glo_EDI_BRP_like_21 4..130 CDD:176706 73/127 (57%)
Glo_EDI_BRP_like 141..255 CDD:211348 55/113 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339747
Domainoid 1 1.000 296 1.000 Domainoid score I1417
eggNOG 1 0.900 - - E1_COG0346
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H9376
Inparanoid 1 1.050 297 1.000 Inparanoid score I2647
OMA 1 1.010 - - QHG59570
OrthoDB 1 1.010 - - D390402at33208
OrthoFinder 1 1.000 - - FOG0005578
OrthoInspector 1 1.000 - - oto98899
orthoMCL 1 0.900 - - OOG6_105403
Panther 1 1.100 - - LDO PTHR46466
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3441
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.