DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1532 and Glo1

DIOPT Version :9

Sequence 1:NP_001285505.1 Gene:CG1532 / 33076 FlyBaseID:FBgn0031143 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_997477.1 Gene:Glo1 / 294320 RGDID:2702 Length:184 Species:Rattus norvegicus


Alignment Length:152 Identity:32/152 - (21%)
Similarity:56/152 - (36%) Gaps:42/152 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VFKIGDRAKNAFFFRQILGMTVLRHEEFKEGCDAACNGPYDNRWSKTMVGYGPE----------- 65
            :.:|.|..|:..|:.::||:|:|:..:|.           ..::|...:.|..:           
  Rat    36 MLRIKDPKKSLDFYTRVLGLTLLQKLDFP-----------SMKFSLYFLAYEDKNDIPKDKTERT 89

  Fly    66 ----SSHFVIELTYNYG-----VSSYEMGND----FGGVTIHSKDILSRAAEH-----SYPVTQV 112
                |....:|||:|:|     ..||..||.    ||.:.|...|:.......     .:.....
  Rat    90 AWAFSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYEACKRFEELGVKFVKKPD 154

  Fly   113 SGKAGSL--LTSPDGYKFYVID 132
            .||...|  :..||||...:::
  Rat   155 DGKMKGLAFVQDPDGYWIEILN 176

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG1532NP_001285505.1 Glo_EDI_BRP_like_21 6..133 CDD:176706 32/152 (21%)
Glo_EDI_BRP_like 143..256 CDD:211348
Glo1NP_997477.1 PLN03042 20..184 CDD:215548 32/152 (21%)