DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1532 and GLO1

DIOPT Version :9

Sequence 1:NP_001285505.1 Gene:CG1532 / 33076 FlyBaseID:FBgn0031143 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_006699.2 Gene:GLO1 / 2739 HGNCID:4323 Length:184 Species:Homo sapiens


Alignment Length:152 Identity:33/152 - (21%)
Similarity:58/152 - (38%) Gaps:42/152 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VFKIGDRAKNAFFFRQILGMTVLRHEEFKEGCDAACNGPYDNRWSKTMVGYGPE----------- 65
            :.::.|..|:..|:.::||||:::          .|:.|. .::|...:.|..:           
Human    36 MLRVKDPKKSLDFYTRVLGMTLIQ----------KCDFPI-MKFSLYFLAYEDKNDIPKEKDEKI 89

  Fly    66 ----SSHFVIELTYNYG-----VSSYEMGND----FGGVTIHSKDILSRAAEH-----SYPVTQV 112
                |....:|||:|:|     ..||..||.    ||.:.|...|:.|.....     .:.....
Human    90 AWALSRKATLELTHNWGTEDDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPD 154

  Fly   113 SGKAGSL--LTSPDGYKFYVID 132
            .||...|  :..||||...:::
Human   155 DGKMKGLAFIQDPDGYWIEILN 176

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG1532NP_001285505.1 Glo_EDI_BRP_like_21 6..133 CDD:176706 33/152 (22%)
Glo_EDI_BRP_like 143..256 CDD:211348
GLO1NP_006699.2 VOC 20..183 CDD:326334 33/152 (22%)