DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and prss60.1

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:267 Identity:88/267 - (32%)
Similarity:128/267 - (47%) Gaps:31/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 SFLLLLAVP-VHS-------APGSLNGRVVGGEDAVKNQFPHQVSLRNA--GSHSCGGSILSRNY 66
            |..|||.|. .||       ||  ||.|:|||.:|....:|.||||.:.  |.|.||||:::..:
Zfish     8 SLALLLCVQGSHSQLNVCGLAP--LNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEW 70

  Fly    67 VLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLR 129
            |||||||:....::...|.:..   |.:.|.|   :..:...|:.:.||..|.|..  ||:|||.
Zfish    71 VLTAAHCLPRITTSSLLVFLGK---TTQQGVN---TYEINRTVSVITVHPSYNNLTNENDIALLH 129

  Fly   130 LESPLILSASIQPIDLPTADT--PADVDVIISGWGRIKHQGDLPR--YLQYNTLKSISLERCDEL 190
            |.|.:..|..|:|:.|...::  |......|:|||.|:...:||.  .||...:..:..::|:.|
Zfish   130 LSSAVTFSNYIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNAL 194

  Fly   191 IGWG--VQSELCL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWS---ACGTSYPDG-YARVYY 248
            :|.|  ..:.:|. :.:.....|.||||||.|....:|.|...:.|   .|...|..| |.||..
Zfish   195 LGSGSVTNNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQ 259

  Fly   249 HNEWIKN 255
            :..||.:
Zfish   260 YQSWINS 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 75/236 (32%)
Tryp_SPc 32..256 CDD:238113 76/239 (32%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 75/236 (32%)
Tryp_SPc 34..267 CDD:238113 76/239 (32%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587842
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.