DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and gzma

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_001335166.1 Gene:gzma / 795070 ZFINID:ZDB-GENE-091204-156 Length:257 Species:Danio rerio


Alignment Length:213 Identity:54/213 - (25%)
Similarity:84/213 - (39%) Gaps:40/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAG 96
            :|||:| ||......||::...:|.|||.::.:.:|||||||  .:||..:        .|:..|
Zfish    28 IVGGKD-VKKALSWMVSIQVNQNHKCGGILIHKEWVLTAAHC--KEDSYSS--------VTVLIG 81

  Fly    97 SNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQPIDLP--TADTPADVDVI 157
            |.....|...:.:....:.|.:....  :|:.|:||..    ....:|..:|  ..|.......:
Zfish    82 SLSLSKGSQRIAIHNYEIPETFNKKTKKDDIMLIRLSK----KVKAKPYKIPKKEKDVQPGTKCV 142

  Fly   158 ISGWGRIKHQG----DLPRYLQYNTLKSISLERC---------DELIGWGVQSELCLIHEADNGA 209
            :.|||...::|    |..:.|:...:..:...|.         |.|.....|..        .|.
Zfish   143 VRGWGTTDYKGKQASDKLQMLEVLVVDRVQCNRYYNRNPVITKDMLCAGNTQQH--------RGT 199

  Fly   210 CNGDSGGPAVYNNQVVGV 227
            |.||||||......:|||
Zfish   200 CLGDSGGPLECEKNLVGV 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 54/213 (25%)
Tryp_SPc 32..256 CDD:238113 54/213 (25%)
gzmaXP_001335166.1 Tryp_SPc 28..247 CDD:238113 54/213 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587685
Domainoid 1 1.000 117 1.000 Domainoid score I5856
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.