DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and gzmk

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017208551.1 Gene:gzmk / 794999 ZFINID:ZDB-GENE-091204-352 Length:267 Species:Danio rerio


Alignment Length:245 Identity:60/245 - (24%)
Similarity:101/245 - (41%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIA 87
            |.|...:..:|||:| ||......||::....|.|||.::.:.:|||:|.|        ..||::
Zfish    29 SLPVCSDVSIVGGKD-VKKALSWMVSIQKEKIHICGGILIHKQWVLTSAQC--------KEVPVS 84

  Fly    88 AERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQPIDLP--TA 148
            :  .|:..||.....|...:.:....:.:.:....  :|:.|:||..    ....:|..:|  ..
Zfish    85 S--VTVLIGSLSLSKGSQRIGILNYEIPKTFNEKTKEDDIMLIRLSK----KVKAKPYKIPKNEK 143

  Fly   149 DTPADVDVIISGWGRIKHQGD-LPRYLQYNTLKSISLERCDELIGWG---VQSELCLIH-EADNG 208
            |.|.....::.|||...::.: ....||...:..:..::|:......   .:..||..: :...|
Zfish   144 DVPPGTKCVVRGWGTTDYKDEQASDKLQMLEVLVVDRDQCNRYYNRNPVITKDMLCAGNTQQHRG 208

  Fly   209 ACNGDSGGPAVYNNQVVGV-AGFVWSACG-TSYPDGYARV-YYHNEWIKN 255
            .|.||||||......:||| :|.  ..|| ...|..|..: ..|..||.:
Zfish   209 TCWGDSGGPLECKKNLVGVISGS--QGCGIPKKPTVYTFLSKRHISWINS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 56/233 (24%)
Tryp_SPc 32..256 CDD:238113 58/236 (25%)
gzmkXP_017208551.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587709
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.