DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Prss36

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:251 Identity:73/251 - (29%)
Similarity:113/251 - (45%) Gaps:28/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTI 93
            :.|:|||.||....:|.||||...|.|.||||:::.::||:||||..   :||...|  |:..::
Mouse    45 SSRIVGGSDAHPGTWPWQVSLHQGGGHICGGSLIAPSWVLSAAHCFV---TNGTLEP--ADELSV 104

  Fly    94 RAGSNDR---FSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTAD--TP 151
            ..|.:.:   ..|..:..||.:::.:.|.  ....|:|||||.||..|..|::|:.||.|.  ..
Mouse   105 LLGVHSQDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLGPSVRPVCLPRASHLFA 169

  Fly   152 ADVDVIISGWGRIKHQGDLPR--YLQYNTLKSISLERCD---------ELIGWGVQSELCLIHEA 205
            .......:|||.::....||.  .||...|:.:....|.         .|....:...||..:.|
Mouse   170 HGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSRPGPFNLTFQLLPGMLCAGYPA 234

  Fly   206 D-NGACNGDSGGPAVYNNQ----VVGVAGFVWSACGTSYPDGYARVYYHNEWIKNN 256
            . ...|.||||||.|..:.    :.|:..|.:.....:.|..:..|..:..||:.:
Mouse   235 GRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAPYESWIREH 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 71/244 (29%)
Tryp_SPc 32..256 CDD:238113 72/246 (29%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 72/246 (29%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.