DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and zgc:153968

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001070924.1 Gene:zgc:153968 / 768292 ZFINID:ZDB-GENE-061027-211 Length:301 Species:Danio rerio


Alignment Length:277 Identity:73/277 - (26%)
Similarity:119/277 - (42%) Gaps:40/277 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKAAILLGSFLLLLAVPVHSAPGS-----------LNGRVVGGEDAVKNQFPHQVSLR--NAGSH 55
            ::.|:.:...|||      :..||           |..|::||:.|:...:|.|||:.  ..|..
Zfish     3 LRLAVCVAGVLLL------NISGSLCQLDVCGRAPLKPRIIGGQTAMAGSWPWQVSIHYIPTGGL 61

  Fly    56 SCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVA-EVIVHEEYG 119
            .|||::::|.:||:||.|...         :.|....:..|........|:...| ::|.|.:|.
Zfish    62 LCGGTLINREWVLSAAQCFQK---------LTASNLVVHLGHLSTGDPNVIHNPASQIINHPKYD 117

  Fly   120 NFL--NDVALLRLESPLILSASIQPIDLPTADTPADVDVI--ISGWGRIKHQG-DLPRYLQYNTL 179
            :..  ||:|||:|.:|:..:..|:|:.|..:.:......:  |:|||.|...| ..|..||...:
Zfish   118 SATNKNDIALLKLSTPVSFTDYIKPVCLTASGSSLGKGAVSWITGWGSINTGGTQFPTTLQEVKI 182

  Fly   180 KSISLERCDELIGWGVQSELCLI--HEADNGACNGDSGGPAVYNNQ----VVGVAGFVWSACGTS 238
            ..:|...|....|..:...:...  :|...|.|.||.|||.|:|:.    ..|:|.|........
Zfish   183 PVVSNGDCKSAYGSLITDGMICAGPNEGGKGICMGDGGGPLVHNSSEQWIQSGIASFGRGCAQPK 247

  Fly   239 YPDGYARVYYHNEWIKN 255
            .|..:.||..:..|||:
Zfish   248 NPGVFTRVSEYESWIKS 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 63/235 (27%)
Tryp_SPc 32..256 CDD:238113 65/238 (27%)
zgc:153968NP_001070924.1 Tryp_SPc 35..262 CDD:214473 63/235 (27%)
Tryp_SPc 36..265 CDD:238113 65/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587703
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.