DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Prss55

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_036014741.1 Gene:Prss55 / 71037 MGIID:1918287 Length:347 Species:Mus musculus


Alignment Length:239 Identity:72/239 - (30%)
Similarity:115/239 - (48%) Gaps:25/239 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRA 95
            |::.|::|...:||.|||::.:..|.|||||||..::||.|||...|:       ::.....:|.
Mouse    60 RIIEGQEAELGEFPWQVSIQESDHHFCGGSILSEWWILTVAHCFYAQE-------LSPTDLRVRV 117

  Fly    96 GSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTADTPAD-VDVI 157
            |:||..:..|.::|..:|.|:.:.  |..||:|||.|..||..:....||.||....|.. .:..
Mouse   118 GTNDLTTSPVELEVTTIIRHKGFKRLNMDNDIALLLLAKPLTFNELTVPICLPLWPAPPSWHECW 182

  Fly   158 ISGWGRIKHQGD---LPRYLQYNTLKSISLERCDELIGWGVQSELCLIHEADN-GACNGDSGGPA 218
            ::||| :.:..|   :...|....::.|..|.|.::......:.||..:..:: .||.||||||.
Mouse   183 VAGWG-VTNSTDKESMSTDLMKVPMRIIEWEECLQMFPSLTTNMLCASYGNESYDACQGDSGGPL 246

  Fly   219 VYNNQ------VVGVAGFVW-SACG-TSYPDGYARVYYHNEWIK 254
            |....      .||:..  | .:|| ..:|..|..:..:..||:
Mouse   247 VCTTDPGSRWYQVGIIS--WGKSCGKKGFPGIYTVLAKYTLWIE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 70/236 (30%)
Tryp_SPc 32..256 CDD:238113 71/238 (30%)
Prss55XP_036014741.1 Tryp_SPc 60..287 CDD:214473 70/236 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.