DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Klk12

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_081373.1 Gene:Klk12 / 69511 MGIID:1916761 Length:247 Species:Mus musculus


Alignment Length:260 Identity:80/260 - (30%)
Similarity:117/260 - (45%) Gaps:36/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQD 78
            |||.||.:..|.   ..::..|.:.|||..|.||.|.:.....|||.::.|.:|||||||     
Mouse     7 LLLCAVGLSQAD---REKIYNGVECVKNSQPWQVGLFHGKYLRCGGVLVDRKWVLTAAHC----- 63

  Fly    79 SNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEV---IVHEEY-GNFLN---DVALLRLESPLIL 136
                     .:::.:|.|.:.........|:...   |.|..| |.:.|   |:.||||..|:.|
Mouse    64 ---------RDKYVVRLGEHSLTKLDWTEQLRHTTFSITHPSYQGAYQNHEHDLRLLRLNRPIHL 119

  Fly   137 SASIQPIDLPTADTPADVDVIISGWGRIKHQGD-LPRYLQYNTLKSISLERCDELI-GWGVQSEL 199
            :.:::|:.||::.........:||||......| .|..||...|.::|.|.|..:. |...::.|
Mouse   120 TRAVRPVALPSSCVTTGAMCHVSGWGTTNKPWDPFPDRLQCLNLSTVSNETCRAVFPGRVTENML 184

  Fly   200 CLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSA---CG-TSYPDGYARVYYHNEW----IKNN 256
            |...||...||.||||||.|....:.|:..  |.:   || ...|..|.:|..:.:|    |:||
Mouse   185 CAGGEAGKDACQGDSGGPLVCGGVLQGLVS--WGSVGPCGQKGIPGVYTKVCKYTDWIRIVIRNN 247

  Fly   257  256
            Mouse   248  247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 71/238 (30%)
Tryp_SPc 32..256 CDD:238113 72/240 (30%)
Klk12NP_081373.1 Tryp_SPc 21..240 CDD:214473 70/234 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.