DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and 2210010C04Rik

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_075822.3 Gene:2210010C04Rik / 67373 MGIID:1914623 Length:247 Species:Mus musculus


Alignment Length:259 Identity:75/259 - (28%)
Similarity:121/259 - (46%) Gaps:26/259 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VKAAILLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVL 68
            :|..|.|......:|:|:...    :.::|||....:|..|:|||| |:|.|.||||:::..:|:
Mouse     1 MKTLIFLAFLGAAVALPLDDD----DDKIVGGYTCQRNALPYQVSL-NSGYHFCGGSLINSQWVV 60

  Fly    69 TAAHCVTNQDSNGNSVPIAAERFTIRAGSN--DRFSGG-VLVQVAEVIVHEEY--GNFLNDVALL 128
            :||||..:             |..:|.|.:  |...|| ..:..|::|.|..|  ..:.||:.|:
Mouse    61 SAAHCYKS-------------RIQVRLGEHNIDALEGGEQFIDAAKIIRHPNYNANTYNNDIMLI 112

  Fly   129 RLESPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQG-DLPRYLQYNTLKSISLERCDELIG 192
            :|::...|::.:..:.||.:...|....::||||.....| :.|..||......:|...|.....
Mouse   113 KLKTAATLNSRVSTVALPRSCPSAGTRCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCTSSYP 177

  Fly   193 WGVQSEL-CL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIK 254
            ..:.|.: || ..|....:|.||||||.|.|.|:.||..:.:.......|..|.:|..:..||:
Mouse   178 GKITSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRGKPGVYTKVCKYVNWIQ 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 68/229 (30%)
Tryp_SPc 32..256 CDD:238113 70/231 (30%)
2210010C04RikNP_075822.3 Tryp_SPc 24..240 CDD:214473 68/229 (30%)
Tryp_SPc 25..243 CDD:238113 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.