DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and TPSB2

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_077078.5 Gene:TPSB2 / 64499 HGNCID:14120 Length:275 Species:Homo sapiens


Alignment Length:274 Identity:91/274 - (33%)
Similarity:131/274 - (47%) Gaps:44/274 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPVHS-------APGSLNGRV--VGGEDAVKNQFPHQVSLR---NAGSHSCGGSILSRNY 66
            |||||:||.:       |||....||  |||::|.::::|.|||||   ....|.||||::...:
Human     4 LLLLALPVLASRAYAAPAPGQALQRVGIVGGQEAPRSKWPWQVSLRVRDRYWMHFCGGSLIHPQW 68

  Fly    67 VLTAAHCVTNQDSNGNSV-PIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLNDVALL 128
            ||||||||      |..| .:||.|..:|  ....:....|:.|:.:|||.::  .....|:|||
Human    69 VLTAAHCV------GPDVKDLAALRVQLR--EQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALL 125

  Fly   129 RLESPLILSASIQPIDLPTADT--PADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLER--CDE 189
            .||.|:.:|:.:..:.||.|..  |..:...::|||.:.:...||.......:|...:|.  ||.
Human   126 ELEEPVNVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDA 190

  Fly   190 LIGWG---------VQSELCLIHEADNGACNGDSGGPAVYNNQVVGV---AGFV-W-SACG-TSY 239
            ....|         |:.::.........:|.||||||.|.  :|.|.   ||.| | ..|. .:.
Human   191 KYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVC--KVNGTWLQAGVVSWGEGCAQPNR 253

  Fly   240 PDGYARVYYHNEWI 253
            |..|.||.|:.:||
Human   254 PGIYTRVTYYLDWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 79/248 (32%)
Tryp_SPc 32..256 CDD:238113 80/249 (32%)
TPSB2NP_077078.5 Tryp_SPc 31..268 CDD:238113 79/247 (32%)
Tryp_SPc 31..267 CDD:214473 77/245 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165152890
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.