DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and zgc:123295

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001032651.1 Gene:zgc:123295 / 641564 ZFINID:ZDB-GENE-051127-11 Length:310 Species:Danio rerio


Alignment Length:278 Identity:85/278 - (30%)
Similarity:141/278 - (50%) Gaps:31/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRSVKAAILLGSFLLLLAVPV------HSAPGSLNGRVVGGEDAVKNQFPHQVSLRNA--GSHSC 57
            |:...|..::|:.|:.:|..:      ..||  ||.::|||::|....:|.||||::.  |.|.|
Zfish     1 MKINTALTVVGALLVNIAGSLCQLNVCGRAP--LNTKIVGGQNAGAGSWPWQVSLQSPTYGGHFC 63

  Fly    58 GGSILSRNYVLTAAHCVTNQDSNGN-SVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNF 121
            |||::::::||:||||.  |||.|. .|.:..:.   ::|||..   .:...|.:||.|..|.|.
Zfish    64 GGSLINKDWVLSAAHCF--QDSIGTIMVKLGLQS---QSGSNPY---QITKTVVQVINHPNYNNP 120

  Fly   122 L--NDVALLRLESPLILSASIQPIDLPTADTPADVDVI--ISGWGRIKHQGD-LPRYLQYNTLKS 181
            .  ||:||::|:|.:..:..|:|:.|..|........:  ::|||::....: :|..||...:..
Zfish   121 SNDNDIALVKLDSSVTFNDYIEPVCLAAAGNTYAAGTLSWVTGWGKLSSAANQIPDILQEVEIPI 185

  Fly   182 ISLERCDELIGWGVQSE-LC--LIHEADNGACNGDSGGPAVYNN--QVV--GVAGFVWSACGTSY 239
            :|...|.......:.|. :|  |:.:....:|.||||||.|..|  |.:  |:..|........|
Zfish   186 VSHSDCKRAYPGEITSNMICAGLLDQGGKDSCQGDSGGPMVSRNGSQWIQSGIVSFGRGCAEPGY 250

  Fly   240 PDGYARVYYHNEWIKNNS 257
            |..||||..:.:||.:::
Zfish   251 PGVYARVSQYQDWITSST 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 74/236 (31%)
Tryp_SPc 32..256 CDD:238113 76/238 (32%)
zgc:123295NP_001032651.1 Tryp_SPc 35..264 CDD:214473 74/236 (31%)
Tryp_SPc 36..264 CDD:238113 74/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170587727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.