DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and AZU1

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001691.1 Gene:AZU1 / 566 HGNCID:913 Length:251 Species:Homo sapiens


Alignment Length:261 Identity:76/261 - (29%)
Similarity:118/261 - (45%) Gaps:43/261 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AILLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAA 71
            |:|.|   ||.:....|:| .|:  :|||..|...|||...|::|.|.|.|||:::...:|:|||
Human     8 ALLAG---LLASSRAGSSP-LLD--IVGGRKARPRQFPFLASIQNQGRHFCGGALIHARFVMTAA 66

  Fly    72 HCVTNQDSNGNSVPIAA-----------ERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLNDV 125
            .|..:|:...::|.:.|           :.|:|.:.|.:.:              :...| |||:
Human    67 SCFQSQNPGVSTVVLGAYDLRRRERQSRQTFSISSMSENGY--------------DPQQN-LNDL 116

  Fly   126 ALLRL--ESPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCD 188
            .||:|  |:.|..|.:|.|:.|..|...|.....::|||..:..|.|.|:.::..:.....::|.
Human   117 MLLQLDREANLTSSVTILPLPLQNATVEAGTRCQVAGWGSQRSGGRLSRFPRFVNVTVTPEDQCR 181

  Fly   189 ELIGWGVQSELCL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEW 252
                   .:.:|. :.....|.||||.|.|.|......|||.|....||.. ||.:.||....:|
Human   182 -------PNNVCTGVLTRRGGICNGDGGTPLVCEGLAHGVASFSLGPCGRG-PDFFTRVALFRDW 238

  Fly   253 I 253
            |
Human   239 I 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 66/235 (28%)
Tryp_SPc 32..256 CDD:238113 68/236 (29%)
AZU1NP_001691.1 Tryp_SPc 27..240 CDD:238113 68/236 (29%)
Possesses antibiotic activity. /evidence=ECO:0000269|PubMed:8506327 46..70 11/23 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.