DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Klk11

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001170844.1 Gene:Klk11 / 56538 MGIID:1929977 Length:276 Species:Mus musculus


Alignment Length:267 Identity:68/267 - (25%)
Similarity:119/267 - (44%) Gaps:32/267 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGSFLLLLAVPVHSAPGSLNG--RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAA 71
            ||.:.::|..:.:....|.:.|  |::.|.:...:..|.||:|.......||.::::..::||||
Mouse    23 LLQARMILRLIALALVTGHVGGETRIIKGYECRPHSQPWQVALFQKTRLLCGATLIAPKWLLTAA 87

  Fly    72 HCVTNQDSNGNSVPIAAERFTIRAGSN--DRFSGGVLVQVA-EVIVHEEYGNFL------NDVAL 127
            ||             ....:.|..|.:  ::..|....::| |...|.::.|.|      ||:.|
Mouse    88 HC-------------RKPHYVILLGEHNLEKTDGCEQRRMATESFPHPDFNNSLPNKDHRNDIML 139

  Fly   128 LRLESPLILSASIQPIDLPTADTPADVDVIISGWGRIKH-QGDLPRYLQYNTLKSISLERCDELI 191
            :::.||:..:.::||:.|......|....:|||||.... |..||..|:...:..|..:.|::..
Mouse   140 VKMSSPVFFTRAVQPLTLSPHCVAAGTSCLISGWGTTSSPQLRLPHSLRCANVSIIEHKECEKAY 204

  Fly   192 GWGV-QSELCL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACG-TSYPDGYARVYYHNEWI 253
            ...: .:.||. :.:....:|.||||||.|.|..:.|:..:....|. |..|..|.:|..:..||
Mouse   205 PGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTKVCKYFNWI 269

  Fly   254 ----KNN 256
                :||
Mouse   270 HEVMRNN 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 59/234 (25%)
Tryp_SPc 32..256 CDD:238113 60/240 (25%)
Klk11NP_001170844.1 Tryp_SPc 47..269 CDD:214473 59/234 (25%)
Tryp_SPc 48..272 CDD:238113 60/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.