DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and si:dkey-33m11.7

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_021335658.1 Gene:si:dkey-33m11.7 / 565163 ZFINID:ZDB-GENE-141216-115 Length:214 Species:Danio rerio


Alignment Length:195 Identity:48/195 - (24%)
Similarity:80/195 - (41%) Gaps:34/195 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 IAAERFTIRAG-SNDRFSGGVLVQVAEVIVHEEYGNFLN--DVALLRLESPLILSASIQPIDLPT 147
            :.|..:|:.|. ..:::|..::     :|.|..|....|  |:.|::|.:|:.|:..:....||.
Zfish     6 VVAGDYTLGANEGTEQYSKPLM-----LIPHPLYNRSTNNADIMLIKLSAPIELNRYVSLAPLPK 65

  Fly   148 ADTP--ADVDVIISGWGRIKHQGDL-PRYLQYNTLKSISLERCDELIGW--GVQSELCLIHEADN 207
            .:|.  |.....:||||...|.|.| |..|:...|..:|..:|:....:  .:.:.:.....:..
Zfish    66 QNTGLLAGRMCRVSGWGSTSHSGGLIPLTLRTVRLPIVSTFKCNSSSSFSGNITANMICAGSSTG 130

  Fly   208 G-----------------ACNGDSGGPAVYNNQVVGVAGFVW-SACG-TSYPDGYARVYYHNEWI 253
            |                 .|.||||||.|.:.:|.|:..  | :.|| ..:|..|..|.....||
Zfish   131 GKDACKNSTQYLCHLIVYLCQGDSGGPLVCDGRVYGLVS--WGNGCGDPRFPGVYTAVSRFRRWI 193

  Fly   254  253
            Zfish   194  193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 46/193 (24%)
Tryp_SPc 32..256 CDD:238113 48/195 (25%)
si:dkey-33m11.7XP_021335658.1 Tryp_SPc <2..196 CDD:238113 48/195 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.