DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and PRSS3

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:252 Identity:78/252 - (30%)
Similarity:119/252 - (47%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNG 81
            :|||...     :.::|||....:|..|:|||| |:|||.||||::|..:|::||||...     
Human   100 VAVPFDD-----DDKIVGGYTCEENSLPYQVSL-NSGSHFCGGSLISEQWVVSAAHCYKT----- 153

  Fly    82 NSVPIAAERFTIRAG--------SNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLIL 136
                    |..:|.|        .|::|     :..|::|.|.:|.  ...||:.|::|.||.::
Human   154 --------RIQVRLGEHNIKVLEGNEQF-----INAAKIIRHPKYNRDTLDNDIMLIKLSSPAVI 205

  Fly   137 SASIQPIDLPTADTPADVDVIISGWGR-IKHQGDLPRYLQYNTLKSISLERCD-ELIGWGVQSEL 199
            :|.:..|.|||....|..:.:|||||. :....|.|..|:......::...|. ...|....|..
Human   206 NARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMF 270

  Fly   200 CL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255
            |: ..|....:|..|||||.|.|.|:.||..:.......:.|..|.:||.:.:|||:
Human   271 CVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKD 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 72/234 (31%)
Tryp_SPc 32..256 CDD:238113 75/237 (32%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 72/234 (31%)
Tryp_SPc 110..328 CDD:238113 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.