DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and PRSS2

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001290343.1 Gene:PRSS2 / 5645 HGNCID:9483 Length:261 Species:Homo sapiens


Alignment Length:258 Identity:77/258 - (29%)
Similarity:127/258 - (49%) Gaps:24/258 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHC---VT 75
            :|.......:||...:.::|||....:|..|:|||| |:|.|.||||::|..:|::|.||   ..
Human     6 ILTFVAAAVAAPFDDDDKIVGGYICEENSVPYQVSL-NSGYHFCGGSLISEQWVVSAGHCYKSAI 69

  Fly    76 NQDSNGNSVPIAAERFTIRAG--------SNDRFSGGVLVQVAEVIVHEEYGN--FLNDVALLRL 130
            |...:|.....  .|..:|.|        .|::|     :..|::|.|.:|.:  ..||:.|::|
Human    70 NSKLSGRGCEY--HRIQVRLGEHNIEVLEGNEQF-----INAAKIIRHPKYNSRTLDNDILLIKL 127

  Fly   131 ESPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQG-DLPRYLQYNTLKSISLERCDELIGWG 194
            .||.::::.:..|.||||...|..:.:|||||.....| |.|..||......:|...|:......
Human   128 SSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLSQAECEASYPGK 192

  Fly   195 VQSELCLIHEADNG--ACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255
            :.:.:..:...:.|  :|.||||||.|.|.::.|:..:.:.....:.|..|.:||.:.:|||:
Human   193 ITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 71/237 (30%)
Tryp_SPc 32..256 CDD:238113 74/240 (31%)
PRSS2NP_001290343.1 Tryp_SPc 23..253 CDD:214473 71/237 (30%)
Tryp_SPc 24..256 CDD:238113 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.