DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and KLK15

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_059979.2 Gene:KLK15 / 55554 HGNCID:20453 Length:256 Species:Homo sapiens


Alignment Length:261 Identity:74/261 - (28%)
Similarity:114/261 - (43%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQD 78
            ||.|:..:.|.......:::.|::...:..|.||:|...|..:||.|::|.::||:||||     
Human     4 LLTLSFLLASTAAQDGDKLLEGDECAPHSQPWQVALYERGRFNCGASLISPHWVLSAAHC----- 63

  Fly    79 SNGNSVPIAAERF-TIRAGSND---RFSGGVLVQVAEVIVHEEY--GNFLNDVALLRLESPLILS 137
                     ..|| .:|.|.::   |.....|...:.||.|..|  .:..||:.||||..|..|:
Human    64 ---------QSRFMRVRLGEHNLRKRDGPEQLRTTSRVIPHPRYEARSHRNDIMLLRLVQPARLN 119

  Fly   138 ASIQPIDLPTADTPADVDVIISGWGRIKH-----------QGDLPRYLQYNTLKSISLERCDELI 191
            ..::|..|||.........::||||.:.|           |..||..|....:..||...||:..
Human   120 PQVRPAVLPTRCPHPGEACVVSGWGLVSHNEPGTAGSPRSQVSLPDTLHCANISIISDTSCDKSY 184

  Fly   192 GWGVQSELCLIHEADNGA--CNGDSGGPAVYNNQVVGVAGFVWSAC-GTSYPDGYARVYYHNEWI 253
            ...:.:.:........||  |.||||||.|....:.|:..:....| .|:.|..|.:|.::.|||
Human   185 PGRLTNTMVCAGAEGRGAESCEGDSGGPLVCGGILQGIVSWGDVPCDNTTKPGVYTKVCHYLEWI 249

  Fly   254 K 254
            :
Human   250 R 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 68/241 (28%)
Tryp_SPc 32..256 CDD:238113 70/243 (29%)
KLK15NP_059979.2 Tryp_SPc 25..249 CDD:214473 68/237 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.