DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Tpsab1

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_062195.2 Gene:Tpsab1 / 54271 RGDID:3066 Length:310 Species:Rattus norvegicus


Alignment Length:281 Identity:81/281 - (28%)
Similarity:132/281 - (46%) Gaps:60/281 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVP-----VHSAPGSLNGR--VVGGEDAVKNQFPHQVSLR---NAGSHSCGGSILSRNYVL 68
            ||||.:|     ||:||.....|  :|||::|..|::|.|||||   ....|.||||::...:||
  Rat    41 LLLLTLPLLSSLVHAAPSLAMPREGIVGGQEASGNKWPWQVSLRVNDTYWMHFCGGSLIHPQWVL 105

  Fly    69 TAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL----NDVALLR 129
            ||||||....::.|.:.:...:..:       :....|:.|:::|.|.::  ::    .|:|||:
  Rat   106 TAAHCVGPNKADPNKLRVQLRKQYL-------YYHDHLLTVSQIISHPDF--YIAQDGADIALLK 161

  Fly   130 LESPLILSASIQPIDLPTADT--PADVDVIISGWGRIKHQGDLPR-----------------YLQ 175
            |.:|:.:::::..:.||.|..  |:.....::|||.|.:...||.                 .|:
  Rat   162 LTNPVNITSNVHTVSLPPASETFPSGTLCWVTGWGNINNDVSLPPPFPLEEVQVPIVENRLCDLK 226

  Fly   176 Y----NTLKSISLERCDELIGWGVQSELCLIHEADNGACNGDSGGPAVYNNQ----VVGVAGFVW 232
            |    ||..::.:.|.|         .||..:|. :.:|.||||||.|...:    ..||..:..
  Rat   227 YHKGLNTGDNVHIVRDD---------MLCAGNEG-HDSCQGDSGGPLVCKVEDTWLQAGVVSWGE 281

  Fly   233 SACGTSYPDGYARVYYHNEWI 253
            .....:.|..|.||.|:.:||
  Rat   282 GCAQPNRPGIYTRVTYYLDWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 70/257 (27%)
Tryp_SPc 32..256 CDD:238113 71/256 (28%)
Tpsab1NP_062195.2 Tryp_SPc 66..302 CDD:214473 69/254 (27%)
Tryp_SPc 66..302 CDD:238113 69/254 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346455
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.