DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Prss53

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:250 Identity:67/250 - (26%)
Similarity:111/250 - (44%) Gaps:40/250 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 APGSLNGRVVGGEDA-VKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIA 87
            |.|||:.   ||..| ..:|:|....|::.|..:|||:::|...|||||||...:.:        
  Rat   334 ACGSLSS---GGPQAGALSQWPWDARLKHHGKLACGGALVSEVVVLTAAHCFIGRQT-------- 387

  Fly    88 AERFTIRAGSNDRFSGGVLVQVAEVIVHEEY----GNFLNDVALLRLESPLILSASIQPIDLPTA 148
            .|.:::..|:.....|     :.::|:|..|    |.  :|||.|.|..|:.|...::|:.||.|
  Rat   388 LEEWSVGLGAGPEEWG-----LKQLILHGAYTHPEGG--HDVAFLLLAQPVTLGPGLRPLCLPYA 445

  Fly   149 D--TPADVDVIISGW--GRIKHQG-DLPRYLQYNTLKSISLERCDELIG-WGV---QSELCLIHE 204
            |  .| |.:   .||  |..:..| :.|..:....|..::..|.....| .||   ...:|....
  Rat   446 DHRLP-DGE---HGWVLGLTREAGINHPHTVPVTVLGPMACSRQHAASGSTGVPILPGMICTTVV 506

  Fly   205 ADNGACNGDSGGPAVYNNQ----VVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255
            .:...|.|.||.|.|:..:    :.|:..|..:..|::.|..:|.:..:.:|:.|
  Rat   507 GEPPHCEGLSGAPLVHEIRGTWFLAGLHSFGDTCQGSAKPAVFAALSAYEDWVSN 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 61/239 (26%)
Tryp_SPc 32..256 CDD:238113 62/241 (26%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 62/238 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.