DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Prss36

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:251 Identity:75/251 - (29%)
Similarity:116/251 - (46%) Gaps:28/251 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTI 93
            :.|:|||.||....:|.||||.:.|.|.||||:::.::||:||||..   :||...|  |:.:::
  Rat    56 SSRIVGGSDAHPGTWPWQVSLHHGGGHICGGSLIAPSWVLSAAHCFV---TNGTLEP--ADEWSV 115

  Fly    94 RAGSNDR---FSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTAD--TP 151
            ..|.:.:   ..|..:..||.::|.:.|.  ....|:|||||.||..|..|::|:.||.|.  ..
  Rat   116 LLGVHSQDGPLEGAHMRSVATILVPDNYSRVELGADLALLRLASPAKLGPSVKPVCLPRASHLFA 180

  Fly   152 ADVDVIISGWGRIKHQGDL--PRYLQYNTLKSISLERCDELIGWG---------VQSELCLIH-E 204
            .......:|||.::....|  |..||...||.:....|..|....         :...||..: |
  Rat   181 HGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFNLTLQLLPGMLCAGYPE 245

  Fly   205 ADNGACNGDSGGPAVYNNQ----VVGVAGFVWSACGTSYPDGYARVYYHNEWIKNN 256
            .....|.||||||.|..:.    :.|:..|.:.....:.|..:..|.::..||:.:
  Rat   246 GRRDTCQGDSGGPLVCEDGGRWFLAGITSFGFGCGRRNRPGVFTAVAHYESWIREH 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 73/244 (30%)
Tryp_SPc 32..256 CDD:238113 74/246 (30%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 74/246 (30%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.