DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and prtn3

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001006847.1 Gene:prtn3 / 448597 XenbaseID:XB-GENE-5805214 Length:245 Species:Xenopus tropicalis


Alignment Length:263 Identity:79/263 - (30%)
Similarity:127/263 - (48%) Gaps:46/263 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHC 73
            ||.:..:|.|..|:.  ||::.::|||.:|..|..|:..||:..|.|.||||:::..:::|||||
 Frog     5 LLVTLSILWASQVNG--GSMHTQIVGGREATPNSHPYIASLQLRGRHFCGGSLIAPQFLMTAAHC 67

  Fly    74 VTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN------FLNDVALLRLES 132
            :.|..||..:|.:.|........:..||.           |::.:.|      ..||:.:|:|:.
 Frog    68 MENTASNLVTVVLGAHSLRANEATKQRFR-----------VNQVFENGFNPLTLQNDIVILKLDR 121

  Fly   133 PLILSASIQPIDLPTA--DTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWGV 195
            |:.|:..:|.:.||:|  |.||....:.:||||:..:|.:|             :|..||.....
 Frog   122 PVSLNGKVQVVSLPSANEDVPAGTQCVTAGWGRLSTEGQIP-------------DRLQELNVTVT 173

  Fly   196 QSELC---------LIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSY-PDGYARVYYHN 250
            :..||         .:.:|  |.|.||||||.|.|..:.|:..|:..:||... ||.::||....
 Frog   174 RQNLCRPNNICTGVFMQQA--GICFGDSGGPLVCNGVIQGITSFIIRSCGNGVTPDFFSRVSLFR 236

  Fly   251 EWI 253
            .:|
 Frog   237 RFI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 71/239 (30%)
Tryp_SPc 32..256 CDD:238113 72/240 (30%)
prtn3NP_001006847.1 Tryp_SPc 26..241 CDD:238113 72/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm47449
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.