DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and KLK12

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:255 Identity:76/255 - (29%)
Similarity:107/255 - (41%) Gaps:43/255 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LGSFLLLLAVPVHSA--PGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAH 72
            |..||||..:.:..|  |...||...|     :|..|.||.|....|..|||.::...:||||||
Human     3 LSIFLLLCVLGLSQAATPKIFNGTECG-----RNSQPWQVGLFEGTSLRCGGVLIDHRWVLTAAH 62

  Fly    73 CVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQV--AEVIVHEEYG----NFL-------ND 124
            |             :..|:.:|.|.:.      |.|:  .|.|.|..:.    .:|       :|
Human    63 C-------------SGSRYWVRLGEHS------LSQLDWTEQIRHSGFSVTHPGYLGASTSHEHD 108

  Fly   125 VALLRLESPLILSASIQPIDLPTADTPADVDVIISGWGRIKH-QGDLPRYLQYNTLKSISLERCD 188
            :.||||..|:.:::|:||:.||.....|..:..:||||...| :...|..||...|..:|...|.
Human   109 LRLLRLRLPVRVTSSVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCH 173

  Fly   189 ELIGWGVQSEL-CLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVY 247
            .:....:.|.: |........||.||||||.|....:.|:..  |.:.|....||...||
Human   174 GVYPGRITSNMVCAGGVPGQDACQGDSGGPLVCGGVLQGLVS--WGSVGPCGQDGIPGVY 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 67/232 (29%)
Tryp_SPc 32..256 CDD:238113 67/231 (29%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 69/237 (29%)
Tryp_SPc 22..236 CDD:238113 69/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.