DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Try10

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001034085.1 Gene:Try10 / 436522 MGIID:3687012 Length:246 Species:Mus musculus


Alignment Length:258 Identity:76/258 - (29%)
Similarity:122/258 - (47%) Gaps:37/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQ 77
            ||.|:...| :.|...:.::|||....:|..|:|||| |:|.|.||||:::..:|::||||..: 
Mouse     6 FLALVGAAV-AFPVDDDDKIVGGYTCRENSVPYQVSL-NSGYHFCGGSLINDQWVVSAAHCYKS- 67

  Fly    78 DSNGNSVPIAAERFTIRAG--------SNDRFSGGVLVQVAEVIVHEEY--GNFLNDVALLRLES 132
                        |..:|.|        .|::|     :..|.:|.|.::  ....||:.|::|.|
Mouse    68 ------------RIQVRLGEHNINVLEGNEQF-----IDAANIIKHPKFKKKTLDNDIMLIKLSS 115

  Fly   133 PLILSASIQPIDLPTADTPADVDVIISGWGRIKHQG----DLPRYLQYNTLKSISLERCDELIGW 193
            |:.|:|.:..:.||::...|....:|||||.....|    ||.:.|....|.....|.  ...|.
Mouse   116 PVTLNARVATVALPSSCAAAGTQCLISGWGNTLSSGVNNPDLLQCLDAPLLPQADCEA--SYPGK 178

  Fly   194 GVQSELCL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255
            ..::.:|: ..|....:|.||||||.|.|.|:.|:..:.:.......|..|.:|..:.:||:|
Mouse   179 ITKNMICVGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKDNPGVYTKVCNYVDWIQN 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 68/236 (29%)
Tryp_SPc 32..256 CDD:238113 71/239 (30%)
Try10NP_001034085.1 Tryp_SPc 23..239 CDD:214473 68/236 (29%)
Tryp_SPc 24..242 CDD:238113 71/239 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.