DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG11313

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651821.3 Gene:CG11313 / 43646 FlyBaseID:FBgn0039798 Length:370 Species:Drosophila melanogaster


Alignment Length:262 Identity:73/262 - (27%)
Similarity:119/262 - (45%) Gaps:45/262 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQF---------PHQ-VSLRNAGSHSCGGSILSRNYVLTAAHCVT--NQDSNGNS 83
            ::..|.:.|..:|         ||. ..||.    .|.||:::..||:||||||:  .:...|: 
  Fly   115 QITKGNETVLTEFAWMVLLEYRPHDGQQLRT----YCAGSLINNRYVVTAAHCVSAATRARKGD- 174

  Fly    84 VPIAAERFTIRAGSN------DRFSGGVL---VQVA--EVIVHEEYGN--FLNDVALLRLESPLI 135
               .:.|.::|.|.:      |..:|..|   ||:|  |:.:||.:|.  |.||:||:||...:.
  Fly   175 ---VSFRVSVRLGEHNTSAVVDCLNGRCLPEPVQIAVEEIRIHESFGTRLFWNDIALIRLAREVA 236

  Fly   136 LSASIQPIDLPTA----DTPADVDVIISGWGRIKHQGDLPRYLQYNTL---KSISLERCDELIGW 193
            .|.||:|:.||:.    :..:.....::||||.......|..::....   ..:...:...::..
  Fly   237 YSPSIRPVCLPSTVGLQNWQSGQAFTVAGWGRTLTSESSPVKMKLRVTYVEPGLCRRKYASIVVL 301

  Fly   194 GVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWS---ACGTSY-PDGYARVYYHNEWIK 254
            | .|.||....:...:|:||||||.:..::.|.|.|.:.|   .||:.: |..|..|..:..||.
  Fly   302 G-DSHLCAEGRSRGDSCDGDSGGPLMAFHEGVWVLGGIVSFGLNCGSRFWPAVYTNVLSYETWIT 365

  Fly   255 NN 256
            .|
  Fly   366 QN 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 70/257 (27%)
Tryp_SPc 32..256 CDD:238113 72/259 (28%)
CG11313NP_651821.3 CLIP 24..78 CDD:288855
Tryp_SPc 116..367 CDD:238113 72/259 (28%)
Tryp_SPc 116..364 CDD:214473 70/256 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457362
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.