DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG9737

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651783.1 Gene:CG9737 / 43600 FlyBaseID:FBgn0039758 Length:424 Species:Drosophila melanogaster


Alignment Length:272 Identity:74/272 - (27%)
Similarity:120/272 - (44%) Gaps:57/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LNGRVVGGEDAVKNQFPHQVSL-RNAGSHSCGGSILSRNYVLTAAHCVTNQ-------------- 77
            :..|:.|||.|..::||....| .|:..:.|.|:::...::|||||||..:              
  Fly   146 VTNRIYGGEIAELDEFPWLALLVYNSNDYGCSGALIDDRHILTAAHCVQGEGVRDRQGLKHVRLG 210

  Fly    78 DSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVA--EVIVHEEYGNF----LNDVALLRLESPLIL 136
            :.|..:.|...|.      .|........:.:|  ::.||.||..|    .||:|::||:.|:..
  Fly   211 EFNVKTEPDCIEE------PNYLSCADAALDIAYEKIHVHPEYKEFSNYKYNDIAIIRLKHPVSF 269

  Fly   137 SASIQPIDLPTADTP---ADVDVI-ISGWGRIKHQGDL----------PRYLQYNTLKSISLERC 187
            :..:.||.||....|   |:..:. :|||||.    ||          |..|:.. :..:|.|.|
  Fly   270 THFVMPICLPNKSEPLTLAEGQMFSVSGWGRT----DLFNKYFINIHSPIKLKLR-IPYVSNENC 329

  Fly   188 DELI-GWGVQ---SELCLIHEADNGACNGDSGGPAVYNNQ------VVGVAGFVWSACG-TSYPD 241
            .::: |:||:   .::|...|.....|.||||||.:|.::      ..||..:.::.|| ...|.
  Fly   330 TKILEGFGVRLGPKQICAGGEFAKDTCAGDSGGPLMYFDRQHSRWVAYGVVSYGFTQCGMAGKPA 394

  Fly   242 GYARVYYHNEWI 253
            .|..|..:.:||
  Fly   395 VYTNVAEYTDWI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 72/267 (27%)
Tryp_SPc 32..256 CDD:238113 73/268 (27%)
CG9737NP_651783.1 CLIP 28..89 CDD:288855
Tryp_SPc 149..406 CDD:214473 72/267 (27%)
Tryp_SPc 150..409 CDD:238113 73/268 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.