DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and intr

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:209 Identity:49/209 - (23%)
Similarity:79/209 - (37%) Gaps:56/209 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 CGGSILSRNYVLTAAHCV--TNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG 119
            |.|:::|...|||:|.|.  |.:.....|..:.|.|..|             ..||.:|.     
  Fly   113 CSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASRSRI-------------YSVANLIT----- 159

  Fly   120 NFLNDVALLRLESPLILSASIQPIDLPTADTPA----DVDVIISGWGRIKHQGDLPRYLQYNTLK 180
            ..:.|:|||.|.:|| ....:.||||  .::|.    :|.:.:|           .::|::...|
  Fly   160 GAIEDMALLLLHAPL-EDPFVHPIDL--CESPLRRNDNVTMYMS-----------QQHLRFLRTK 210

  Fly   181 SISLERC------DELIGWGVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSY 239
            .|....|      || ..:..|:.||.::......|....|...::.:::.||     ...|...
  Fly   211 LIPNSNCKRSYAQDE-NAFITQTMLCALNSNRLVDCQTAKGDVLLHQDRLCGV-----DIYGQHC 269

  Fly   240 PDG------YARVY 247
            .||      ||.|:
  Fly   270 SDGGVNGELYADVF 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 49/209 (23%)
Tryp_SPc 32..256 CDD:238113 49/209 (23%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 49/209 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.