DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG34129

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001036760.1 Gene:CG34129 / 43181 FlyBaseID:FBgn0083965 Length:314 Species:Drosophila melanogaster


Alignment Length:210 Identity:43/210 - (20%)
Similarity:83/210 - (39%) Gaps:27/210 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVI 113
            |...|:.:||.:..:...|:|:|:|:....::.....:....|:  ....:.::....:|..|..
  Fly    60 LNGDGNFACGAAYYAPLLVITSANCIYPYRNSLEGATVEGTAFS--ECDRENYADIDTIQFPEKF 122

  Fly   114 VHEEYGNFLNDVALLRLESPL---------ILSASIQPIDLPTADTPADVDVIISGWGRIKHQGD 169
            :   |.....|||::||..|:         :.|..:||          .:.:::.|||....:.:
  Fly   123 I---YQKLYMDVAVVRLRDPVRGRLTEFIRLCSVKVQP----------KMQMVVFGWGFDNTEVE 174

  Fly   170 LPRYLQYN-TLKSISLERCDELIGWG--VQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFV 231
            :|.....| |:..||::.|.:.....  ..:.:|.....:...|..|.|.|.:|..::.||..|.
  Fly   175 IPSSDPRNVTVTIISIKECRQKFKSPKIASTSICARQPKNPKQCLYDGGSPLIYGRELCGVVSFG 239

  Fly   232 WSACGTSYPDGYARV 246
            .....||.|..|..:
  Fly   240 SHCIDTSRPGMYTNI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 43/210 (20%)
Tryp_SPc 32..256 CDD:238113 43/210 (20%)
CG34129NP_001036760.1 Tryp_SPc 39..261 CDD:214473 43/210 (20%)
Tryp_SPc 55..261 CDD:304450 43/210 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.