DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and Tmprss11c

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001003979.1 Gene:Tmprss11c / 408213 RGDID:1302967 Length:418 Species:Rattus norvegicus


Alignment Length:256 Identity:81/256 - (31%)
Similarity:124/256 - (48%) Gaps:44/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAE 89
            ||  ..:|.||:||.:.::|.|.||:....|.||.:::|.::::|||||                
  Rat   182 PG--GHKVAGGQDAEEGEWPWQASLQQNNVHRCGATLISNSWLITAAHC---------------- 228

  Fly    90 RFTIRAGSND-RFSGGVLVQ-------VAEVIVHEEYG----NFLNDVALLRLESPLILSASIQP 142
             |...|...| :.|.|.|:.       |..:::||.|.    |  ||:|::||.||::...:|:.
  Rat   229 -FVRSANPKDWKVSFGFLLSKPQAQRAVKSIVIHENYSYPAHN--NDIAVVRLSSPVLYENNIRR 290

  Fly   143 IDLP--TADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWG---VQSELCL- 201
            ..||  |...|.:.||:::|||.:|..||.|..||...:|.|..:.|:....:|   ....||. 
  Rat   291 ACLPEATQKFPPNSDVVVTGWGTLKSDGDSPNILQKGRVKIIDNKTCNSGKAYGGVITPGMLCAG 355

  Fly   202 IHEADNGACNGDSGGPAVYNNQ--VVGVAGFV-W-SACG-TSYPDGYARVYYHNEWIKNNS 257
            ..|....||.||||||.|..:.  :..:||.| | ..|. .:.|..|.||.::.:||.:.:
  Rat   356 FLEGRVDACQGDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTHYRDWISSKT 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 77/244 (32%)
Tryp_SPc 32..256 CDD:238113 79/246 (32%)
Tmprss11cNP_001003979.1 SEA 62..157 CDD:279699
Tryp_SPc 186..412 CDD:214473 77/244 (32%)
Tryp_SPc 187..415 CDD:238113 79/246 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.