DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG10587

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:255 Identity:71/255 - (27%)
Similarity:109/255 - (42%) Gaps:30/255 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 PGSLNGRVVGGEDAVKNQF-PHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAA 88
            || ...|||||:.....|. .:.::||...:..|||::|....|||||||...:....:.:.:..
  Fly    40 PG-FQTRVVGGDVTTNAQLGGYLIALRYEMNFVCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGG 103

  Fly    89 ERFTIRAGSNDRFSGGVLVQVAEVIVHEEY--GNFLNDVALLRLESPLILSASIQPIDLPTADTP 151
                 .:..|||   |:..||.|||...|:  .:...|||:|||:.|: ...|:..:.|......
  Fly   104 -----ASKLNDR---GIQRQVKEVIKSAEFREDDMNMDVAILRLKKPM-KGKSLGQLILCKKQLM 159

  Fly   152 ADVDVIISGWGRIKHQGDLP-RYLQYNTLKSISLERCDEL---IGWGVQSELCL---IHEADN-- 207
            ...::.:||||..::....| :.|:..|:..:..::|...   ..|.......|   :|..|:  
  Fly   160 PGTELRVSGWGLTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMF 224

  Fly   208 --------GACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKNNSDV 259
                    .||..|||||.||.|||.|:..|........|...|..:.|...:|:.:..|
  Fly   225 CAGVLGKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFIEQSIKV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 67/241 (28%)
Tryp_SPc 32..256 CDD:238113 67/243 (28%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 67/241 (28%)
Tryp_SPc 46..280 CDD:238113 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.