DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG9372

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_649132.1 Gene:CG9372 / 40137 FlyBaseID:FBgn0036891 Length:408 Species:Drosophila melanogaster


Alignment Length:256 Identity:68/256 - (26%)
Similarity:116/256 - (45%) Gaps:47/256 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHS--CGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTI 93
            |:.||..|..:::|...:|...|...  |||.:::..:|||||||:..::.         |...:
  Fly   173 RLTGGRPAEPDEWPWMAALLQEGLPFVWCGGVLITDRHVLTAAHCIYKKNK---------EDIFV 228

  Fly    94 RAGSNDRFSGGVL-------VQVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTAD 149
            |.|   .::..:|       .::|.:::|.:|.  |:.||:|::|::...|.:..|.|:.:|..:
  Fly   229 RLG---EYNTHMLNETRARDFRIANMVLHIDYNPQNYDNDIAIVRIDRATIFNTYIWPVCMPPVN 290

  Fly   150 TP-ADVDVIISGWGRIKHQG---------DLPRYLQYNTLKSISLERCDELIGWGVQSELCL-IH 203
            .. :|.:.|::|||..|..|         :||.:.|.:...|......|        :.:|. ..
  Fly   291 EDWSDRNAIVTGWGTQKFGGPHSNILMEVNLPVWKQSDCRSSFVQHVPD--------TAMCAGFP 347

  Fly   204 EADNGACNGDSGGPAVY---NNQVVGVAGFVWS-ACG-TSYPDGYARVYYHNEWIKNNSDV 259
            |....:|.||||||.:.   |.:.|.:....|. .|| ...|..|.||..:.:||..|:||
  Fly   348 EGGQDSCQGDSGGPLLVQLPNQRWVTIGIVSWGVGCGQRGRPGIYTRVDRYLDWILANADV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 63/248 (25%)
Tryp_SPc 32..256 CDD:238113 64/250 (26%)
CG9372NP_649132.1 CLIP 87..132 CDD:197829
Tryp_SPc 173..402 CDD:214473 63/248 (25%)
Tryp_SPc 176..402 CDD:238113 62/245 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457730
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.