DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG32374

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_729270.1 Gene:CG32374 / 38848 FlyBaseID:FBgn0052374 Length:299 Species:Drosophila melanogaster


Alignment Length:244 Identity:71/244 - (29%)
Similarity:116/244 - (47%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 AVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGN 82
            |:....|...|..|:|.|:....::.|:|.:|.......||..||:|.::|||.||     ..||
  Fly    60 AINALEAQDYLPTRIVNGKKIKCSRAPYQCALHYNNYFICGCVILNRRWILTAQHC-----KIGN 119

  Fly    83 SVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASIQPIDL 145
                 ..|:|:||||..:..||.|..|.:.:.|..|..:.  ||:.:::|::||.:...:|.:.|
  Fly   120 -----PGRYTVRAGSTQQRRGGQLRHVQKTVCHPNYSEYTMKNDLCMMKLKTPLNVGRCVQKVKL 179

  Fly   146 PTADTPA-DVDVIISGWGRIK-HQGDLPRYLQYNTLKSISLERC-DELIGWGVQ--SELCLIHEA 205
            |:..|.. ....:.||||... :..::.|||:...:..:|..:| .:..|.|::  .::......
  Fly   180 PSTRTKRFPKCYLASGWGLTSANAQNVQRYLRGVIVCKVSRAKCQQDYRGTGIKIYKQMICAKRK 244

  Fly   206 DNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIK 254
            :...|:||||||.|:|..:.|:..|........||..|..|..:..|||
  Fly   245 NRDTCSGDSGGPLVHNGVLYGITSFGIGCASAKYPGVYVNVLQYTRWIK 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 65/228 (29%)
Tryp_SPc 32..256 CDD:238113 67/230 (29%)
CG32374NP_729270.1 Tryp_SPc 73..292 CDD:214473 65/228 (29%)
Tryp_SPc 74..295 CDD:238113 67/230 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.