DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG16998

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_648134.1 Gene:CG16998 / 38847 FlyBaseID:FBgn0035795 Length:258 Species:Drosophila melanogaster


Alignment Length:253 Identity:69/253 - (27%)
Similarity:111/253 - (43%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPVHSAPG-SLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQ 77
            |:||.:..|.... |...|:|||.:...:..|...|:...|::||..::::..:::||.|||...
  Fly     6 LILLLICGHKTSALSPQERIVGGVEVPIHLTPWLASITVHGNYSCSSALITSLWLVTAGHCVQYP 70

  Fly    78 DSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYG--NFLNDVALLRLESPLILSASI 140
            ||           :::||||.....||....|..||:|.::.  ...||:|||:|:....|..:|
  Fly    71 DS-----------YSVRAGSTFTDGGGQRRNVVSVILHPDFNLRTLENDIALLKLDKSFTLGGNI 124

  Fly   141 QPIDLPTAD---TPADVDVIISGWGR--IKHQGDLPRYLQYNTLKSISLERCDEL---IGWGVQS 197
            |.:.||...   .|.  .::::|||.  .......|| |:...:|.|:...|..|   :...:..
  Fly   125 QVVKLPLPSLNILPR--TLLVAGWGNPDATDSESEPR-LRGTVVKVINQRLCQRLYSHLHRPITD 186

  Fly   198 ELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255
            ::.....|....|.||||.|.|:.....|:..|........:|..|.|:..:..||.|
  Fly   187 DMVCAAGAGRDHCYGDSGAPLVHRGSSYGIVSFAHGCADPHFPGVYTRLANYVTWIFN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 61/231 (26%)
Tryp_SPc 32..256 CDD:238113 63/234 (27%)
CG16998NP_648134.1 Tryp_SPc 24..242 CDD:214473 61/231 (26%)
Tryp_SPc 25..242 CDD:238113 60/230 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.