DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG6462

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:252 Identity:85/252 - (33%)
Similarity:122/252 - (48%) Gaps:37/252 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RVVGGEDAVKNQFPHQV----SLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERF 91
            |:.|||.|.:..||:||    .|..|....||||:::..:|||||||:|:        .|||:.:
  Fly    76 RIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTD--------AIAAKIY 132

  Fly    92 ---TIRAGSNDRFSGGVLVQVA--EVIVHEEYGNF--LNDVALLRLESPLILSASIQPIDLP--- 146
               |:.|...|....   :||.  :.|::.:|..|  .:|:||:||...:..|..:|||:|.   
  Fly   133 TGATVFADVEDSVEE---LQVTHRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIELAGEF 194

  Fly   147 -TADTPADVDVIISGWGRIKHQGD-LPRYLQYNTLKSISLERCDELIGWGVQSE---LCLIHEAD 206
             ..:......|.:||||.:....| ..|.|||...:.|..|||......|:.|:   ||......
  Fly   195 MHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLPGLVSQRRHLCTDGSNG 259

  Fly   207 NGACNGDSGGPAVYN----NQVVGVAGFVWSA--CGTSYPDGYARVYYHNEWIKNNS 257
            .||||||||||.||:    :.::||..| .||  |....|..|.|:..:..||:..:
  Fly   260 RGACNGDSGGPVVYHWRNVSYLIGVTSF-GSAEGCEVGGPTVYTRITAYLPWIRQQT 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 83/246 (34%)
Tryp_SPc 32..256 CDD:238113 84/248 (34%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 83/246 (34%)
Tryp_SPc 77..314 CDD:238113 84/248 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473229
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.