DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG14990

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_647856.2 Gene:CG14990 / 38486 FlyBaseID:FBgn0035496 Length:322 Species:Drosophila melanogaster


Alignment Length:282 Identity:76/282 - (26%)
Similarity:117/282 - (41%) Gaps:69/282 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 SAPGSLNGRVVGGED-AVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPI 86
            |.|..|...|...:| :...|||..|:|.:.|.:...||:::...|||||..|..:..       
  Fly    51 SNPNGLVANVKVPKDYSTPGQFPWVVALFSQGKYFGAGSLIAPEVVLTAASIVVGKTD------- 108

  Fly    87 AAERFTIRAG------------SNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILS 137
             || ..:|||            |.||       .||.|:.|.|:...|  |::|||.|.:|..|.
  Fly   109 -AE-IVVRAGEWNTGQRSEFLPSEDR-------PVARVVQHREFSYLLGANNIALLFLANPFELK 164

  Fly   138 ASIQPIDLPTADTPADVD-VIISGWGRI----KHQGDLPRYLQYNTLKSISLERCDELI---GWG 194
            :.|:.|.||:.....|.. .:::|||::    ::..::.:.::   |..|:..:|.:.:   ..|
  Fly   165 SHIRTICLPSQGRSFDQKRCLVTGWGKVAFNDENYSNIQKKIE---LPMINRAQCQDQLRNTRLG 226

  Fly   195 VQSEL-----CLIHEADNGACNGDSGG---------PAVYNNQVVGVAGFV-WS-AC-GTSYPDG 242
            |..:|     |...|.|.|.|.||.|.         |:.|..     ||.| |. .| ..:.|..
  Fly   227 VSFDLPASLICAGGEKDAGDCLGDGGSALFCPMEADPSRYEQ-----AGIVNWGIGCQEENVPAV 286

  Fly   243 YARVYYHNEWI-----KNNSDV 259
            |..|....:||     :|::.|
  Fly   287 YTNVEMFRDWIYEHMAQNSNSV 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 69/261 (26%)
Tryp_SPc 32..256 CDD:238113 71/268 (26%)
CG14990NP_647856.2 Tryp_SPc 67..300 CDD:238113 69/256 (27%)
Tryp_SPc 67..297 CDD:214473 67/253 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.