DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG32277

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:273 Identity:75/273 - (27%)
Similarity:118/273 - (43%) Gaps:49/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLLLAVP-VHSAPGS-----LNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAA 71
            ::||:.:. :|...||     ..|::.||:..:.......|:||..|...|||.|:|.|.|||||
  Fly     2 YILLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAA 66

  Fly    72 HCV-------------TNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGNFLN 123
            ||:             ..|...|:.:|....|.....|.:..:..              .....:
  Fly    67 HCLEGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCA--------------QRGLDS 117

  Fly   124 DVALLRLESPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQG-DLPRYLQYNTLKSISLERC 187
            |:|::||..|..::.:...:.:...|.|...::.:.|||.|..|| :..:.||...:|.||...|
  Fly   118 DLAVIRLSRPFDIAGNASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHREC 182

  Fly   188 DELIGWGVQ----SELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWS-ACGTSYPDGYAR-- 245
            .:.:|.|.|    :..|.:.:....||.|||||||:|..:.||:..  |. .||:.||..|.|  
  Fly   183 IKSVGSGWQKVTNNMFCALGKNARDACQGDSGGPAIYAGRSVGIVS--WGYGCGSGYPGVYTRLS 245

  Fly   246 ---VYYHNEWIKN 255
               :.|   |:|:
  Fly   246 SPSITY---WLKD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 67/245 (27%)
Tryp_SPc 32..256 CDD:238113 69/248 (28%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 66/235 (28%)
Tryp_SPc 27..246 CDD:238113 66/234 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.