DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG3650

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:253 Identity:65/253 - (25%)
Similarity:111/253 - (43%) Gaps:48/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLAVPVHSAPGSLNGRVVGGEDAVKNQF-PHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQD 78
            |||.:    |.|.:..|:|||.....:.. ...|:||..|:..||||:::.::|:|||||:....
  Fly    13 LLLGL----ASGQIQPRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAHCLKGYQ 73

  Fly    79 SNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEY-GNFLN-DVALLRLESPLILSASIQ 141
                     |.|.|::.|.:.....||:.:||...:...: .:.|| ||.::||:|.| ..:.|.
  Fly    74 ---------ASRITVQGGVSKLSQSGVVRRVARYFIPNGFSSSSLNWDVGVIRLQSAL-TGSGIT 128

  Fly   142 PIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELIGWGVQSELCLIHEAD 206
            .|.|..........:.:||||..::....|.    |.|:::.::.        ::.::|  ..|.
  Fly   129 TIPLCQVQWNPGNYMRVSGWGTTRYGNSSPS----NQLRTVRIQL--------IRKKVC--QRAY 179

  Fly   207 NG-----------------ACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVY 247
            .|                 :|:|||||..::.||:.|:..:........||..|..|:
  Fly   180 QGRDTLTASTFCARTGGKDSCSGDSGGGVIFKNQLCGIVSWGLGCANAQYPGVYTSVH 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 60/237 (25%)
Tryp_SPc 32..256 CDD:238113 59/236 (25%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 60/237 (25%)
Tryp_SPc 26..243 CDD:238113 59/236 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.