DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and tpr

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_611611.1 Gene:tpr / 37486 FlyBaseID:FBgn0034661 Length:372 Species:Drosophila melanogaster


Alignment Length:251 Identity:71/251 - (28%)
Similarity:114/251 - (45%) Gaps:38/251 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SLNGRVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERF 91
            ::..|:|||::...:|:|....|...|...|..|:|:..::|||:|||..         ...||.
  Fly   122 NIQKRIVGGQETEVHQYPWVAMLLYGGRFYCAASLLNDQFLLTASHCVYG---------FRKERI 177

  Fly    92 TIRAGSNDRFSGGVLV---QVAEVIVHEEYG--NFLNDVALLRLESPLILSASIQPIDLPTADTP 151
            ::|...:||....:..   :|||||.|.:|.  |:.||:|:::|:.|:..:..:.|:.:||....
  Fly   178 SVRLLEHDRKMSHMQKIDRKVAEVITHPKYNARNYDNDIAIIKLDEPVEFNEVLHPVCMPTPGRS 242

  Fly   152 -ADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERC----------DELIGWGVQSELCLIHEA 205
             ...:.|::|||.:|..|.....||...:..:|.:.|          |.::..|..       |.
  Fly   243 FKGENGIVTGWGALKVGGPTSDTLQEVQVPILSQDECRKSRYGNKITDNMLCGGYD-------EG 300

  Fly   206 DNGACNGDSGGP------AVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIKN 255
            ...:|.||||||      ....:|:.||..:........||..||||..:..||||
  Fly   301 GKDSCQGDSGGPLHIVASGTREHQIAGVVSWGEGCAKAGYPGVYARVNRYGTWIKN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 67/243 (28%)
Tryp_SPc 32..256 CDD:238113 70/246 (28%)
tprNP_611611.1 Tryp_SPc 126..354 CDD:214473 67/243 (28%)
Tryp_SPc 127..356 CDD:238113 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457763
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.