DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and CG8299

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_611066.1 Gene:CG8299 / 36751 FlyBaseID:FBgn0034052 Length:260 Species:Drosophila melanogaster


Alignment Length:277 Identity:89/277 - (32%)
Similarity:128/277 - (46%) Gaps:46/277 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 AILLGSFLL-LLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAG---SHSCGGSILSRNYV 67
            ::.||.||| .|.|.:.:...|::..:|||:.|....||:|||:|...   .|.|||||.:...|
  Fly     2 SLRLGLFLLAALGVVILTDSASISTHIVGGDQADIADFPYQVSVRLETYMLLHICGGSIYAPRVV 66

  Fly    68 LTAAHCVTNQDSNGNSVPIAAERFTIRAGSN---DRFSGGVLVQVAEVIVHEEYG--NFLNDVAL 127
            :|||||:..:         .|....|.||.|   |....|  |:|:::|.|..|.  .::||:.|
  Fly    67 ITAAHCIKGR---------YASYIRIVAGQNSIADLEEQG--VKVSKLIPHAGYNKKTYVNDIGL 120

  Fly   128 LRLESPLILSASIQPIDLPTADTPADVDVIISGWG-RIKHQGDLPRYLQYNTLKSISLERC---- 187
            :....||..||.:|||.:.....|:....::|||| |.:....||..|:...|:.|....|    
  Fly   121 IITREPLEYSALVQPIAVALEAPPSGAQAVVSGWGKRAEDDEALPAMLRAVELQIIEKSTCGAQY 185

  Fly   188 --------DELIGWGVQSELCLIH-EADNGACNGDSGGPAVYNNQVVGVAGFVWS-ACG-TSYPD 241
                    ||:        ||..: |.....||||||||...:..:|||..  |. .|| ..:|.
  Fly   186 LTKDYTVTDEM--------LCAGYLEGGKDTCNGDSGGPLAVDGVLVGVVS--WGVGCGREGFPG 240

  Fly   242 GYARVYYHNEWIKNNSD 258
            .|..|..|.:||:..::
  Fly   241 VYTSVNSHIDWIEEQAE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 79/245 (32%)
Tryp_SPc 32..256 CDD:238113 81/247 (33%)
CG8299NP_611066.1 Tryp_SPc 27..252 CDD:214473 79/245 (32%)
Tryp_SPc 28..255 CDD:238113 81/247 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.