DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1304 and thetaTry

DIOPT Version :9

Sequence 1:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:264 Identity:82/264 - (31%)
Similarity:130/264 - (49%) Gaps:28/264 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLLLAVPVHSA-----------PGSLNGRVVGGEDAVKNQFPHQVSLR-NAGSHSCGGSILSRNY 66
            :||:.:.|.||           |....||:|||||......|:||||: .:|||.||||:::.:.
  Fly     6 VLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGSHFCGGSLINEDT 70

  Fly    67 VLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFSGGVLVQVAEVIVHEEYGN--FLNDVALLR 129
            |:|||||:.     |..|    .:..:|.||.....||::|.|.|:..:|:|.:  ...||.:|:
  Fly    71 VVTAAHCLV-----GRKV----SKVFVRLGSTLYNEGGIVVAVRELAYNEDYNSKTMEYDVGILK 126

  Fly   130 LESPLILSASIQPIDLPTADTPADVDVIISGWGRIKHQG--DLPRYLQYNTLKSISLERC--DEL 190
            |:..:..:.:|:.|:|.|...|.....:::|||...:..  .||:.||...:..:..:.|  ||.
  Fly   127 LDEKVKETENIRYIELATETPPTGTTAVVTGWGSKCYFWCMTLPKTLQEVYVNIVDWKTCASDEY 191

  Fly   191 -IGWGVQSELCLIHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWIK 254
             .|..:...:...:|....||.||||||....|.:||:..:.::......|..|:.|....:||.
  Fly   192 KYGEIIYDSMVCAYEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPGVYSDVPALRKWIL 256

  Fly   255 NNSD 258
            |.|:
  Fly   257 NASE 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 71/229 (31%)
Tryp_SPc 32..256 CDD:238113 72/231 (31%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 71/229 (31%)
Tryp_SPc 35..255 CDD:238113 70/228 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.